Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7466.t1
Gene name
Locationscaffold_23:255293..257441
Strand-
Gene length (bp)2148
Transcript length (bp)1953
Coding sequence length (bp)1953
Protein length (aa) 651

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05645 RNA_pol_Rpc82 RNA polymerase III subunit RPC82 3.2E-21 186 482
PF08221 HTH_9 RNA polymerase III subunit RPC82 helix-turn-helix domain 2.8E-09 9 66

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0003677 DNA binding Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0003676 nucleic acid binding No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0009058 biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0003674 molecular_function No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0018130 heterocycle biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:1901363 heterocyclic compound binding No
GO:0090304 nucleic acid metabolic process No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 27.95 16.23 39.67
5d_25C Five days - 25 degrees Celsius 34.67 20.66 48.68
7d_25C Seven days - 25 degrees Celsius 40.82 24.54 57.11
10d_25C Ten days - 25 degrees Celsius 37.57 22.42 52.71
7d_15C Seven days - 15 degrees Celsius 35.53 21.16 49.90
7d_30C Seven days - 30 degrees Celsius 36.32 21.68 50.97

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.399726 no
3d_25C 7d_25C 0.093704 no
3d_25C 7d_15C 0.335045 no
3d_25C 7d_30C 0.283229 no
3d_25C 10d_25C 0.210128 no
5d_25C 7d_25C 0.546207 no
5d_25C 7d_15C 0.943520 no
5d_25C 7d_30C 0.888383 no
5d_25C 10d_25C 0.794037 no
7d_25C 7d_15C 0.617884 no
7d_25C 7d_30C 0.685715 no
7d_25C 10d_25C 0.787675 no
7d_15C 7d_30C 0.951506 no
7d_15C 10d_25C 0.864027 no
7d_30C 10d_25C 0.923744 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7466.t1
MMMSQCSTELCMLLIEDNFGELFARIFTVLQRYERLTLPRLRFYARLTDRQLHHGLSAMIQHHLIYHFTSLDDGN
TYYEANPQAAYSLVRSGKILQLVETRLGEYAAQVLEAIMSLGHSSIAHLETLPELQSKRQRIPNGVNQGENTVEN
TVEDTVDGNGEKEEDSAAPNGNHVVREKPVHLHPTLKSLASHGYIHRLREAHFQSPNDNWIDASRIIASRPDVKQ
MKGKQQATEIEEKAKDLVKERTEGDLSRGLIYNGLPQGAKRKRDHGNSESNKQAPNGTNGVNGDHVEDEGEEDND
WSEDEDGVDSIPMDSNLIVRVNYEKLDVALRNTRFLDLAKQDAPSASVEIYDCLLRRIEYQTARCRDSYEIPREG
EEGEQYSAPIQLSSIVEDVDPNLDLTGCIGPMEPSTVLNRGGKRPLDDETNGVNGDEHEDEPSGQNRAYGIDQHL
SILSQPPLNLTTKHVISGLPTWRVAFRGLARKLRHLELERMIESRYGDVALRVVRVLHAKGKLDEKRLQEISLLP
FKDLRQTLASMQTGGFVDLQEVPRDAQRQPSKTIYLWYYDPDRVCSSMLEDTYKAMSRCLQRIKFERGRERDFLE
KTERTDVKGHEEEFLSEAELEHLRNWKAKEALLLAEVSRLDDMVAVFRDY*
Coding >Pro_DTO377G3_2|g7466.t1
ATGATGATGTCTCAGTGCTCTACCGAGCTTTGTATGCTCTTGATCGAAGACAATTTTGGAGAGCTCTTTGCCCGC
ATCTTTACCGTCCTTCAACGTTATGAAAGACTGACTCTCCCTCGGTTGAGATTCTACGCTCGCCTGACAGATCGC
CAATTGCACCATGGTCTCTCCGCTATGATCCAGCACCACCTGATATACCACTTCACTTCCCTCGATGATGGCAAT
ACCTACTACGAAGCTAATCCACAAGCCGCATACTCCCTCGTGCGATCTGGAAAGATTCTCCAGCTTGTTGAAACT
CGATTGGGAGAATACGCGGCTCAGGTGTTGGAAGCAATCATGAGTCTCGGTCACTCCTCGATCGCCCACCTCGAG
ACGCTTCCGGAGCTTCAATCCAAGAGGCAGCGCATTCCGAATGGGGTTAATCAGGGTGAAAATACGGTCGAAAAT
ACGGTCGAAGATACGGTCGATGGGAACGGGGAAAAGGAAGAAGATTCAGCTGCTCCTAACGGCAATCATGTTGTC
AGGGAAAAACCGGTGCACCTTCATCCCACCTTGAAGAGTCTCGCCTCTCACGGATACATCCATCGTCTTCGAGAG
GCACATTTCCAAAGTCCGAACGACAACTGGATAGATGCTTCCCGAATCATCGCGTCAAGACCAGATGTCAAACAA
ATGAAAGGCAAACAGCAAGCAACGGAGATTGAGGAGAAGGCGAAGGACTTGGTCAAGGAAAGAACTGAAGGAGAT
CTGAGCAGGGGCCTAATATACAACGGCCTCCCTCAAGGCGCCAAAAGAAAACGCGATCATGGCAACTCGGAGTCC
AATAAGCAGGCGCCTAATGGCACTAACGGTGTCAACGGGGACCATGTAGAGGACGAGGGGGAAGAGGATAATGAT
TGGTCGGAAGATGAAGATGGCGTTGATTCAATCCCAATGGATTCTAACCTTATCGTTCGGGTGAACTACGAGAAA
CTCGACGTGGCGCTTCGAAACACGCGGTTCCTCGACCTTGCTAAGCAAGATGCACCTTCCGCCTCAGTTGAGATT
TATGACTGTCTGCTTCGTCGCATTGAATACCAAACAGCCCGCTGCCGAGACTCTTATGAAATCCCTCGTGAAGGA
GAAGAAGGCGAGCAATATTCTGCTCCAATTCAACTGAGCTCAATCGTCGAAGACGTTGACCCGAATCTGGATCTT
ACAGGATGTATTGGCCCGATGGAGCCCTCAACGGTGTTAAACCGAGGCGGCAAGCGACCATTGGATGATGAGACG
AATGGCGTGAATGGTGACGAGCATGAAGATGAACCGAGCGGGCAGAACCGCGCCTATGGAATTGACCAGCACCTT
AGTATTCTCTCACAACCTCCCTTGAACCTTACCACAAAACACGTCATCTCCGGGCTCCCAACGTGGCGAGTTGCA
TTCCGAGGCCTGGCCCGCAAGCTTCGCCATTTAGAACTGGAGCGCATGATTGAATCACGGTATGGAGATGTGGCA
CTGCGGGTGGTCCGCGTCCTGCATGCCAAGGGTAAGCTTGACGAGAAACGGCTCCAAGAAATCAGTCTCCTACCC
TTTAAAGATTTGCGCCAGACGCTTGCTAGCATGCAAACTGGAGGGTTTGTGGACTTGCAGGAAGTGCCGCGTGAC
GCACAGCGCCAGCCTTCCAAGACAATCTACCTGTGGTACTACGATCCAGATCGAGTGTGCAGCAGTATGCTGGAG
GATACGTACAAAGCCATGTCACGGTGCCTGCAGCGCATCAAATTCGAACGTGGCCGCGAGAGAGATTTTCTCGAG
AAGACAGAACGAACCGACGTCAAGGGCCACGAGGAAGAATTCCTCTCGGAGGCGGAATTAGAACATCTTCGCAAC
TGGAAGGCCAAGGAAGCCTTGCTGCTGGCGGAGGTATCTCGATTAGATGACATGGTTGCTGTTTTCCGTGATTAT
TGA
Transcript >Pro_DTO377G3_2|g7466.t1
ATGATGATGTCTCAGTGCTCTACCGAGCTTTGTATGCTCTTGATCGAAGACAATTTTGGAGAGCTCTTTGCCCGC
ATCTTTACCGTCCTTCAACGTTATGAAAGACTGACTCTCCCTCGGTTGAGATTCTACGCTCGCCTGACAGATCGC
CAATTGCACCATGGTCTCTCCGCTATGATCCAGCACCACCTGATATACCACTTCACTTCCCTCGATGATGGCAAT
ACCTACTACGAAGCTAATCCACAAGCCGCATACTCCCTCGTGCGATCTGGAAAGATTCTCCAGCTTGTTGAAACT
CGATTGGGAGAATACGCGGCTCAGGTGTTGGAAGCAATCATGAGTCTCGGTCACTCCTCGATCGCCCACCTCGAG
ACGCTTCCGGAGCTTCAATCCAAGAGGCAGCGCATTCCGAATGGGGTTAATCAGGGTGAAAATACGGTCGAAAAT
ACGGTCGAAGATACGGTCGATGGGAACGGGGAAAAGGAAGAAGATTCAGCTGCTCCTAACGGCAATCATGTTGTC
AGGGAAAAACCGGTGCACCTTCATCCCACCTTGAAGAGTCTCGCCTCTCACGGATACATCCATCGTCTTCGAGAG
GCACATTTCCAAAGTCCGAACGACAACTGGATAGATGCTTCCCGAATCATCGCGTCAAGACCAGATGTCAAACAA
ATGAAAGGCAAACAGCAAGCAACGGAGATTGAGGAGAAGGCGAAGGACTTGGTCAAGGAAAGAACTGAAGGAGAT
CTGAGCAGGGGCCTAATATACAACGGCCTCCCTCAAGGCGCCAAAAGAAAACGCGATCATGGCAACTCGGAGTCC
AATAAGCAGGCGCCTAATGGCACTAACGGTGTCAACGGGGACCATGTAGAGGACGAGGGGGAAGAGGATAATGAT
TGGTCGGAAGATGAAGATGGCGTTGATTCAATCCCAATGGATTCTAACCTTATCGTTCGGGTGAACTACGAGAAA
CTCGACGTGGCGCTTCGAAACACGCGGTTCCTCGACCTTGCTAAGCAAGATGCACCTTCCGCCTCAGTTGAGATT
TATGACTGTCTGCTTCGTCGCATTGAATACCAAACAGCCCGCTGCCGAGACTCTTATGAAATCCCTCGTGAAGGA
GAAGAAGGCGAGCAATATTCTGCTCCAATTCAACTGAGCTCAATCGTCGAAGACGTTGACCCGAATCTGGATCTT
ACAGGATGTATTGGCCCGATGGAGCCCTCAACGGTGTTAAACCGAGGCGGCAAGCGACCATTGGATGATGAGACG
AATGGCGTGAATGGTGACGAGCATGAAGATGAACCGAGCGGGCAGAACCGCGCCTATGGAATTGACCAGCACCTT
AGTATTCTCTCACAACCTCCCTTGAACCTTACCACAAAACACGTCATCTCCGGGCTCCCAACGTGGCGAGTTGCA
TTCCGAGGCCTGGCCCGCAAGCTTCGCCATTTAGAACTGGAGCGCATGATTGAATCACGGTATGGAGATGTGGCA
CTGCGGGTGGTCCGCGTCCTGCATGCCAAGGGTAAGCTTGACGAGAAACGGCTCCAAGAAATCAGTCTCCTACCC
TTTAAAGATTTGCGCCAGACGCTTGCTAGCATGCAAACTGGAGGGTTTGTGGACTTGCAGGAAGTGCCGCGTGAC
GCACAGCGCCAGCCTTCCAAGACAATCTACCTGTGGTACTACGATCCAGATCGAGTGTGCAGCAGTATGCTGGAG
GATACGTACAAAGCCATGTCACGGTGCCTGCAGCGCATCAAATTCGAACGTGGCCGCGAGAGAGATTTTCTCGAG
AAGACAGAACGAACCGACGTCAAGGGCCACGAGGAAGAATTCCTCTCGGAGGCGGAATTAGAACATCTTCGCAAC
TGGAAGGCCAAGGAAGCCTTGCTGCTGGCGGAGGTATCTCGATTAGATGACATGGTTGCTGTTTTCCGTGATTAT
TGA
Gene >Pro_DTO377G3_2|g7466.t1
ATGATGATGTCTCAGGTATGCGACTGTCCCGCTAACCTCGAGAGAGCTACTTACTGACATGAACGTAGTGCTCTA
CCGAGCTTTGTATGCTCTTGATCGAAGACAATTTTGGAGAGCTCTTTGCCGTGAGTCATCTTGTGCACACGCTCG
GGCTATCATGGTTCTCTGCGACAGCGGGGAAGGAACCGGGCTAACTAGTCAACTTTTCGCAGCGCATCTTTACCG
TCCTTCAACGTTATGAAAGACTGACTCTCCCTCGGTTGAGATTCTACGCTCGCCTGACAGATCGCCAATTGCACC
ATGGTCTCTCCGCTATGATCCAGCACCACCTGATATACCACTTCACTTCCCTCGATGATGGCAATACCTACTACG
AAGCTAATCCACAAGCCGCATACTCCCTCGTGCGATCTGGAAAGATTCTCCAGCTTGTTGAAACTCGATTGGGAG
AATACGCGGCTCAGGTGTTGGAAGCAATCATGAGTCTCGGTCACTCCTCGATCGCCCACCTCGAGACGCTTCCGG
AGCTTCAATCCAAGAGGCAGCGCATTCCGAATGGGGTTAATCAGGGTGAAAATACGGTCGAAAATACGGTCGAAG
ATACGGTCGATGGGAACGGGGAAAAGGAAGAAGATTCAGCTGCTCCTAACGGCAATCATGTTGTCAGGGAAAAAC
CGGTGCACCTTCATCCCACCTTGAAGAGTCTCGCCTCTCACGGATACATCCATCGTCTTCGAGAGGCACATTTCC
AAAGTCCGAACGACAACTGGATAGATGCTTCCCGAATCATCGCGTCAAGACCAGATGTCAAACAAATGAAAGGCA
AACAGCAAGCAACGGAGATTGAGGAGAAGGCGAAGGACTTGGTCAAGGAAAGAACTGAAGGAGATCTGAGCAGGG
GCCTAATATACAACGGCCTCCCTCAAGGCGCCAAAAGAAAACGCGATCATGGCAACTCGGAGTCCAATAAGCAGG
CGCCTAATGGCACTAACGGTGTCAACGGGGACCATGTAGAGGACGAGGGGGAAGAGGATAATGATTGGTCGGAAG
ATGAAGATGGCGTTGATTCAATCCCAATGGATGTAAGTTTTCCTTTTTCCTTGCCACGGCTTCGGGTCAACTAAT
AACCATTACCAGTCTAACCTTATCGTTCGGGTGAACTACGAGAAACTCGACGTGGCGCTTCGAAACACGCGGTTC
CTCGACCTTGCTAAGCAAGATGCACCTTCCGCCTCAGTTGAGATTTATGACTGTCTGCTTCGTCGCATTGAATAC
CAAACAGCCCGCTGCCGAGACTCTTATGAAATCCCTCGTGAAGGAGAAGAAGGCGAGCAATATTCTGCTCCAATT
CAACTGAGCTCAATCGTCGAAGACGTTGACCCGAATCTGGATCTTACAGGATGTATTGGCCCGATGGAGCCCTCA
ACGGTGTTAAACCGAGGCGGCAAGCGACCATTGGATGATGAGACGAATGGCGTGAATGGTGACGAGCATGAAGAT
GAACCGAGCGGGCAGAACCGCGCCTATGGAATTGACCAGCACCTTAGTATTCTCTCACAACCTCCCTTGAACCTT
ACCACAAAACACGTCATCTCCGGGCTCCCAACGTGGCGAGTTGCATTCCGAGGCCTGGCCCGCAAGCTTCGCCAT
TTAGAACTGGAGCGCATGATTGAATCACGGTATGGAGATGTGGCACTGCGGGTGGTCCGCGTCCTGCATGCCAAG
GGTAAGCTTGACGAGAAACGGCTCCAAGAAATCAGTCTCCTACCCTTTAAAGATTTGCGCCAGACGCTTGCTAGC
ATGCAAACTGGAGGGTTTGTGGACTTGCAGGAAGTGCCGCGTGACGCACAGCGCCAGCCTTCCAAGACAATCTAC
CTGTGGTACTACGATCCAGATCGAGTGTGCAGCAGTATGCTGGAGGATACGTACAAAGCCATGTCACGGTGCCTG
CAGCGCATCAAATTCGAACGTGGCCGCGAGAGAGATTTTCTCGAGAAGACAGAACGAACCGACGTCAAGGGCCAC
GAGGAAGAATTCCTCTCGGAGGCGGAATTAGAACATCTTCGCAACTGGAAGGCCAAGGAAGCCTTGCTGCTGGCG
GAGGTATCTCGATTAGATGACATGGTTGCTGTTTTCCGTGATTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail