Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7462.t1
Gene name
Locationscaffold_23:246072..246896
Strand-
Gene length (bp)824
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13417 GST_N_3 Glutathione S-transferase, N-terminal domain 2.3E-12 20 102
PF13409 GST_N_2 Glutathione S-transferase, N-terminal domain 1.9E-10 22 96

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7462.t1
MADHSEPDIVLYDLACTKHVSFSPVVWRIRLMLNYKNIPYKTIFLEFPDIEPTLKELGLVPEKSASGSKYTVPAI
QHVPTNTYIMDSLPIAQFLESIYPNPPVPLTSELGREIETKARGVLGKAIYSSVMPREIRILSPRSQEYFRRTRE
ASLGHRLEDLLDEGKEEQVWSDVSAAMGAVGELIRTNKADGPFVLGARPSYTDFFIAGSLQSIRVVDEGVFQRMI
GYPGYGEVYEACLSYMGKRD*
Coding >Pro_DTO377G3_2|g7462.t1
ATGGCCGACCACTCCGAGCCCGATATCGTCTTGTACGATTTGGCCTGTACTAAGCACGTCAGCTTTTCTCCCGTT
GTCTGGCGCATTCGCCTCATGCTCAACTATAAGAACATTCCTTACAAGACTATTTTCCTCGAGTTTCCGGACATT
GAACCCACGCTAAAAGAACTTGGCCTGGTTCCAGAAAAGTCCGCATCGGGATCCAAATACACTGTCCCCGCAATC
CAACATGTGCCAACCAATACATACATTATGGACTCGCTCCCGATCGCGCAGTTCCTAGAGTCGATTTACCCAAAC
CCACCCGTACCACTAACATCAGAACTTGGTCGGGAGATCGAGACCAAGGCACGCGGTGTGCTTGGCAAGGCCATC
TACTCGTCAGTGATGCCACGCGAGATCCGCATCTTATCGCCACGCTCACAAGAGTATTTCCGGCGCACGCGCGAA
GCCTCCCTCGGGCACCGTCTTGAAGATCTCCTTGACGAGGGTAAAGAAGAGCAGGTCTGGAGTGATGTTAGCGCC
GCCATGGGCGCTGTTGGCGAGCTGATCCGGACAAACAAGGCGGACGGACCGTTTGTGCTCGGTGCGCGGCCAAGC
TACACTGATTTCTTCATTGCTGGATCCCTTCAGTCTATTAGAGTGGTTGATGAAGGGGTGTTTCAGAGGATGATC
GGGTACCCTGGCTATGGGGAGGTTTATGAGGCATGTCTGTCTTACATGGGAAAGAGGGATTGA
Transcript >Pro_DTO377G3_2|g7462.t1
ATGGCCGACCACTCCGAGCCCGATATCGTCTTGTACGATTTGGCCTGTACTAAGCACGTCAGCTTTTCTCCCGTT
GTCTGGCGCATTCGCCTCATGCTCAACTATAAGAACATTCCTTACAAGACTATTTTCCTCGAGTTTCCGGACATT
GAACCCACGCTAAAAGAACTTGGCCTGGTTCCAGAAAAGTCCGCATCGGGATCCAAATACACTGTCCCCGCAATC
CAACATGTGCCAACCAATACATACATTATGGACTCGCTCCCGATCGCGCAGTTCCTAGAGTCGATTTACCCAAAC
CCACCCGTACCACTAACATCAGAACTTGGTCGGGAGATCGAGACCAAGGCACGCGGTGTGCTTGGCAAGGCCATC
TACTCGTCAGTGATGCCACGCGAGATCCGCATCTTATCGCCACGCTCACAAGAGTATTTCCGGCGCACGCGCGAA
GCCTCCCTCGGGCACCGTCTTGAAGATCTCCTTGACGAGGGTAAAGAAGAGCAGGTCTGGAGTGATGTTAGCGCC
GCCATGGGCGCTGTTGGCGAGCTGATCCGGACAAACAAGGCGGACGGACCGTTTGTGCTCGGTGCGCGGCCAAGC
TACACTGATTTCTTCATTGCTGGATCCCTTCAGTCTATTAGAGTGGTTGATGAAGGGGTGTTTCAGAGGATGATC
GGGTACCCTGGCTATGGGGAGGTTTATGAGGCATGTCTGTCTTACATGGGAAAGAGGGATTGA
Gene >Pro_DTO377G3_2|g7462.t1
ATGGCCGACCACTCCGAGCCCGATATCGTCTTGTACGATTTGGCCTGTACTAAGCACGTCAGCTTTTCTCCCGTT
GTCTGGCGCATTCGCCTCATGCTCAACTATAAGAACATTCCTTACAAGACTATTTTCCTCGAGTTTCCGGACATT
GAACCCACGCTAAAAGAACTGTGCGTTACAGATTACCCTTGTGTTTTCATGCTTTCCAGCACTGTTTACACGCGA
GGAAACCCCCAGCTAACCCCGAATCACCAAGTGGCCTGGTTCCAGAAAAGTCCGCATCGGGATCCAAATACACTG
TCCCCGCAATCCAACATGTGCCAACCAATACATACATTATGGACTCGCTCCCGATCGCGCAGTTCCTAGAGTCGA
TTTACCCAAACCCACCCGTACCACTAACATCAGAACTTGGTCGGGAGATCGAGACCAAGGCACGCGGTGTGCTTG
GCAAGGCCATCTACTCGTCAGTGATGCCACGCGAGATCCGCATCTTATCGCCACGCTCACAAGAGTATTTCCGGC
GCACGCGCGAAGCCTCCCTCGGGCACCGTCTTGAAGATCTCCTTGACGAGGGTAAAGAAGAGCAGGTCTGGAGTG
ATGTTAGCGCCGCCATGGGCGCTGTTGGCGAGCTGATCCGGACAAACAAGGCGGACGGACCGTTTGTGCTCGGTG
CGCGGCCAAGCTACACTGATTTCTTCATTGCTGGATCCCTTCAGTCTATTAGAGTGGTTGATGAAGGGGTGTTTC
AGAGGATGATCGGGTACCCTGGCTATGGGGAGGTTTATGAGGCATGTCTGTCTTACATGGGAAAGAGGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail