Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7454.t1
Gene name
Locationscaffold_23:212290..213931
Strand+
Gene length (bp)1641
Transcript length (bp)1581
Coding sequence length (bp)1581
Protein length (aa) 527

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain 7.2E-26 62 177
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.3E-07 395 455

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 18.61 9.35 27.87
5d_25C Five days - 25 degrees Celsius 18.43 9.25 27.61
7d_25C Seven days - 25 degrees Celsius 22.65 11.92 33.39
10d_25C Ten days - 25 degrees Celsius 29.85 16.66 43.03
7d_15C Seven days - 15 degrees Celsius 15.37 7.32 23.43
7d_30C Seven days - 30 degrees Celsius 20.45 10.50 30.39

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.982417 no
3d_25C 7d_25C 0.545748 no
3d_25C 7d_15C 0.575760 no
3d_25C 7d_30C 0.805491 no
3d_25C 10d_25C 0.066129 no
5d_25C 7d_25C 0.520444 no
5d_25C 7d_15C 0.600085 no
5d_25C 7d_30C 0.783421 no
5d_25C 10d_25C 0.059176 no
7d_25C 7d_15C 0.165132 no
7d_25C 7d_30C 0.779257 no
7d_25C 10d_25C 0.315189 no
7d_15C 7d_30C 0.356480 no
7d_15C 10d_25C 0.008133 yes
7d_30C 10d_25C 0.149271 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7454.t1
MADMTQVPINGNYPAQHGYPESYNHASVTMNTAASFQPAQSSTPTTVTPTDQQKNEISKDEVGWYFVEQFYTTMS
RNPDKLHLFYSRRSQLVFGTEAESVPVTVGTKAINEKLSSLKFQECKVRVLNVDSQASFDNILVSVIGEISNNSE
PSRKFVQTFVLAEQPNGYYVLNDIFRYMAEEPEEEPEQPTPAAPTAEAPEAVAEVPAEEHQVIDEVTLSDVDEKL
EEVEANEQVEEPKEAAPQTNGVPAEEAAPAAVLAVEAENLNDEEPATPEPSPIAEKGEVPEKETSTAPAAPKTWA
SIATTSFAAKAAAAAKASAAQAAPAAQVTPAVPTAPKSAAPAAPAAPTAQPAAATPAPAEVARSPEAPSTEAGWQ
TAGDGHKKSQPRVEETVLAYIKNVNDKVDASLLKQTLARFGKLKYFDVSRPKNCAFVEFNEPAGYTAAVAANPHQ
IGSEQILVEERRPRGNAYGSNAFPAGRGGGAGRGRGDRAGSQGRGGFQREGRGGFTPRGRGGNVAAKGRPSQPQA
A*
Coding >Pro_DTO377G3_2|g7454.t1
ATGGCCGATATGACTCAGGTTCCTATCAATGGTAACTACCCTGCTCAGCACGGTTACCCTGAATCTTACAACCAT
GCATCTGTCACTATGAACACTGCTGCCAGCTTCCAGCCTGCGCAGTCCTCCACCCCGACTACCGTCACTCCCACC
GACCAGCAGAAGAACGAGATCTCCAAGGATGAGGTGGGCTGGTACTTCGTCGAGCAGTTCTACACCACCATGAGC
CGCAACCCCGACAAGCTTCACTTGTTCTACTCTCGCCGCTCTCAGTTGGTCTTCGGCACTGAGGCTGAGTCGGTT
CCCGTCACCGTTGGTACTAAGGCCATCAACGAGAAGCTTAGCTCCTTGAAGTTCCAGGAGTGCAAAGTGCGCGTC
CTGAATGTCGATTCTCAGGCGTCTTTCGACAACATCCTGGTCTCAGTCATTGGTGAGATCTCGAACAACTCCGAG
CCGTCCCGCAAGTTCGTGCAGACTTTCGTCCTCGCCGAGCAGCCCAACGGCTACTATGTGCTTAACGACATCTTC
CGGTACATGGCCGAAGAGCCAGAAGAAGAACCCGAGCAGCCCACCCCGGCTGCGCCTACTGCTGAAGCTCCTGAG
GCTGTTGCCGAGGTTCCCGCTGAGGAGCACCAGGTGATTGATGAAGTAACTCTCTCAGACGTCGATGAGAAGCTT
GAGGAGGTCGAGGCCAACGAGCAGGTTGAGGAGCCCAAGGAGGCCGCTCCTCAGACTAACGGTGTCCCCGCTGAG
GAGGCGGCTCCAGCTGCGGTTCTTGCCGTCGAGGCTGAAAACCTGAACGACGAGGAGCCCGCCACCCCTGAGCCC
TCTCCTATTGCCGAGAAGGGGGAGGTTCCTGAGAAGGAGACCTCAACCGCTCCCGCTGCTCCTAAGACCTGGGCT
AGCATTGCGACTACCTCTTTCGCAGCTAAGGCCGCTGCTGCCGCCAAGGCTTCGGCTGCCCAGGCTGCTCCTGCT
GCTCAGGTTACCCCTGCTGTTCCTACTGCTCCCAAGTCTGCTGCTCCCGCTGCTCCCGCTGCCCCTACCGCTCAG
CCCGCTGCTGCCACCCCCGCCCCTGCGGAGGTTGCCCGTTCCCCGGAGGCCCCTTCCACCGAAGCCGGCTGGCAG
ACGGCCGGCGATGGCCACAAGAAGTCGCAGCCCCGTGTTGAGGAGACCGTCCTCGCCTATATCAAGAACGTCAAC
GACAAGGTTGATGCCAGCCTGCTTAAGCAGACCCTGGCCCGTTTCGGCAAGCTGAAGTACTTCGATGTCAGCCGC
CCCAAGAACTGTGCCTTTGTTGAATTCAACGAGCCTGCCGGTTATACCGCTGCCGTTGCTGCCAACCCCCACCAG
ATTGGCAGCGAGCAGATCCTCGTCGAGGAGCGCCGCCCACGTGGTAACGCTTACGGTAGCAACGCTTTCCCTGCC
GGCCGTGGTGGTGGTGCGGGTCGTGGTCGCGGTGACCGCGCCGGCAGCCAGGGCCGTGGTGGCTTCCAGCGTGAA
GGCCGCGGCGGTTTCACTCCTCGTGGCCGTGGTGGCAACGTTGCCGCCAAAGGTCGCCCTAGCCAGCCCCAAGCT
GCTTAA
Transcript >Pro_DTO377G3_2|g7454.t1
ATGGCCGATATGACTCAGGTTCCTATCAATGGTAACTACCCTGCTCAGCACGGTTACCCTGAATCTTACAACCAT
GCATCTGTCACTATGAACACTGCTGCCAGCTTCCAGCCTGCGCAGTCCTCCACCCCGACTACCGTCACTCCCACC
GACCAGCAGAAGAACGAGATCTCCAAGGATGAGGTGGGCTGGTACTTCGTCGAGCAGTTCTACACCACCATGAGC
CGCAACCCCGACAAGCTTCACTTGTTCTACTCTCGCCGCTCTCAGTTGGTCTTCGGCACTGAGGCTGAGTCGGTT
CCCGTCACCGTTGGTACTAAGGCCATCAACGAGAAGCTTAGCTCCTTGAAGTTCCAGGAGTGCAAAGTGCGCGTC
CTGAATGTCGATTCTCAGGCGTCTTTCGACAACATCCTGGTCTCAGTCATTGGTGAGATCTCGAACAACTCCGAG
CCGTCCCGCAAGTTCGTGCAGACTTTCGTCCTCGCCGAGCAGCCCAACGGCTACTATGTGCTTAACGACATCTTC
CGGTACATGGCCGAAGAGCCAGAAGAAGAACCCGAGCAGCCCACCCCGGCTGCGCCTACTGCTGAAGCTCCTGAG
GCTGTTGCCGAGGTTCCCGCTGAGGAGCACCAGGTGATTGATGAAGTAACTCTCTCAGACGTCGATGAGAAGCTT
GAGGAGGTCGAGGCCAACGAGCAGGTTGAGGAGCCCAAGGAGGCCGCTCCTCAGACTAACGGTGTCCCCGCTGAG
GAGGCGGCTCCAGCTGCGGTTCTTGCCGTCGAGGCTGAAAACCTGAACGACGAGGAGCCCGCCACCCCTGAGCCC
TCTCCTATTGCCGAGAAGGGGGAGGTTCCTGAGAAGGAGACCTCAACCGCTCCCGCTGCTCCTAAGACCTGGGCT
AGCATTGCGACTACCTCTTTCGCAGCTAAGGCCGCTGCTGCCGCCAAGGCTTCGGCTGCCCAGGCTGCTCCTGCT
GCTCAGGTTACCCCTGCTGTTCCTACTGCTCCCAAGTCTGCTGCTCCCGCTGCTCCCGCTGCCCCTACCGCTCAG
CCCGCTGCTGCCACCCCCGCCCCTGCGGAGGTTGCCCGTTCCCCGGAGGCCCCTTCCACCGAAGCCGGCTGGCAG
ACGGCCGGCGATGGCCACAAGAAGTCGCAGCCCCGTGTTGAGGAGACCGTCCTCGCCTATATCAAGAACGTCAAC
GACAAGGTTGATGCCAGCCTGCTTAAGCAGACCCTGGCCCGTTTCGGCAAGCTGAAGTACTTCGATGTCAGCCGC
CCCAAGAACTGTGCCTTTGTTGAATTCAACGAGCCTGCCGGTTATACCGCTGCCGTTGCTGCCAACCCCCACCAG
ATTGGCAGCGAGCAGATCCTCGTCGAGGAGCGCCGCCCACGTGGTAACGCTTACGGTAGCAACGCTTTCCCTGCC
GGCCGTGGTGGTGGTGCGGGTCGTGGTCGCGGTGACCGCGCCGGCAGCCAGGGCCGTGGTGGCTTCCAGCGTGAA
GGCCGCGGCGGTTTCACTCCTCGTGGCCGTGGTGGCAACGTTGCCGCCAAAGGTCGCCCTAGCCAGCCCCAAGCT
GCTTAA
Gene >Pro_DTO377G3_2|g7454.t1
ATGGCCGATATGACTCAGGTTCCTATCAATGGTAACTACCCTGCTCAGCACGGTTACCCTGAATCTTACAACCAT
GCATCTGTCACTATGAACACTGCTGCCAGCTTCCAGCCTGCGCAGTCCTCCACCCCGACTACCGTCACTCCCACC
GACCAGCAGAAGAACGAGATCTCCAAGGATGAGGTGGGCTGGTACTTCGTCGAGCAGTTCTACACCACCATGAGC
CGCAACCCCGACAAGCTTCACTTGTTCTACTCTCGCCGCTCTCAGTTGGTCTTCGGCACTGAGGCTGAGTCGGTT
CCCGTCACCGTTGGTACTAAGGTGAGTTAGATTCGATTCCTCAATGTGAATATCGCCTAACCACGCACCCCACTC
CCATAGGCCATCAACGAGAAGCTTAGCTCCTTGAAGTTCCAGGAGTGCAAAGTGCGCGTCCTGAATGTCGATTCT
CAGGCGTCTTTCGACAACATCCTGGTCTCAGTCATTGGTGAGATCTCGAACAACTCCGAGCCGTCCCGCAAGTTC
GTGCAGACTTTCGTCCTCGCCGAGCAGCCCAACGGCTACTATGTGCTTAACGACATCTTCCGGTACATGGCCGAA
GAGCCAGAAGAAGAACCCGAGCAGCCCACCCCGGCTGCGCCTACTGCTGAAGCTCCTGAGGCTGTTGCCGAGGTT
CCCGCTGAGGAGCACCAGGTGATTGATGAAGTAACTCTCTCAGACGTCGATGAGAAGCTTGAGGAGGTCGAGGCC
AACGAGCAGGTTGAGGAGCCCAAGGAGGCCGCTCCTCAGACTAACGGTGTCCCCGCTGAGGAGGCGGCTCCAGCT
GCGGTTCTTGCCGTCGAGGCTGAAAACCTGAACGACGAGGAGCCCGCCACCCCTGAGCCCTCTCCTATTGCCGAG
AAGGGGGAGGTTCCTGAGAAGGAGACCTCAACCGCTCCCGCTGCTCCTAAGACCTGGGCTAGCATTGCGACTACC
TCTTTCGCAGCTAAGGCCGCTGCTGCCGCCAAGGCTTCGGCTGCCCAGGCTGCTCCTGCTGCTCAGGTTACCCCT
GCTGTTCCTACTGCTCCCAAGTCTGCTGCTCCCGCTGCTCCCGCTGCCCCTACCGCTCAGCCCGCTGCTGCCACC
CCCGCCCCTGCGGAGGTTGCCCGTTCCCCGGAGGCCCCTTCCACCGAAGCCGGCTGGCAGACGGCCGGCGATGGC
CACAAGAAGTCGCAGCCCCGTGTTGAGGAGACCGTCCTCGCCTATATCAAGAACGTCAACGACAAGGTTGATGCC
AGCCTGCTTAAGCAGACCCTGGCCCGTTTCGGCAAGCTGAAGTACTTCGATGTCAGCCGCCCCAAGAACTGTGCC
TTTGTTGAATTCAACGAGCCTGCCGGTTATACCGCTGCCGTTGCTGCCAACCCCCACCAGATTGGCAGCGAGCAG
ATCCTCGTCGAGGAGCGCCGCCCACGTGGTAACGCTTACGGTAGCAACGCTTTCCCTGCCGGCCGTGGTGGTGGT
GCGGGTCGTGGTCGCGGTGACCGCGCCGGCAGCCAGGGCCGTGGTGGCTTCCAGCGTGAAGGCCGCGGCGGTTTC
ACTCCTCGTGGCCGTGGTGGCAACGTTGCCGCCAAAGGTCGCCCTAGCCAGCCCCAAGCTGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail