Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7453.t1
Gene name
Locationscaffold_23:211688..212181
Strand+
Gene length (bp)493
Transcript length (bp)387
Coding sequence length (bp)387
Protein length (aa) 129

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22
2 85 107 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 14.44 2.68 26.20
5d_25C Five days - 25 degrees Celsius 16.72 3.65 29.78
7d_25C Seven days - 25 degrees Celsius 18.23 3.97 32.50
10d_25C Ten days - 25 degrees Celsius 39.75 13.30 66.19
7d_15C Seven days - 15 degrees Celsius 7.67 0.41 14.92
7d_30C Seven days - 30 degrees Celsius 26.02 7.25 44.79

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.815420 no
3d_25C 7d_25C 0.686099 no
3d_25C 7d_15C 0.194014 no
3d_25C 7d_30C 0.176561 no
3d_25C 10d_25C 0.010735 yes
5d_25C 7d_25C 0.898032 no
5d_25C 7d_15C 0.097721 no
5d_25C 7d_30C 0.349120 no
5d_25C 10d_25C 0.031312 yes
7d_25C 7d_15C 0.067780 no
7d_25C 7d_30C 0.482707 no
7d_25C 10d_25C 0.062138 no
7d_15C 7d_30C 0.007779 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.337067 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7453.t1
MNSAGRWPPAKATRNPHGVEVKEVLFFEGKFPQLHSISFFTHIFSIFLIFLSNPPHLPLRAIRTENSFSLHLYFP
LFRNLKAPRFFLVLYVISFYPLQLLALVLRLFRISSEGNTTIPFLERSSLSSS*
Coding >Pro_DTO377G3_2|g7453.t1
ATGAATTCTGCCGGGCGGTGGCCACCCGCCAAGGCCACGCGAAACCCGCACGGAGTCGAAGTGAAGGAAGTTCTT
TTCTTCGAAGGCAAATTCCCACAGCTTCATTCCATCTCGTTTTTTACCCACATTTTCTCGATCTTTCTCATCTTT
CTCTCAAACCCTCCACATCTCCCTCTCCGCGCCATCAGAACCGAGAACTCTTTCTCACTTCACCTATACTTCCCG
CTTTTCCGCAATCTCAAAGCGCCTCGCTTTTTTTTGGTTCTTTACGTGATTTCCTTCTATCCTCTTCAATTGCTT
GCATTGGTGCTGCGTTTATTTCGCATCTCAAGCGAGGGAAACACGACAATTCCATTTTTAGAACGTTCATCGCTT
TCTTCTTCATAA
Transcript >Pro_DTO377G3_2|g7453.t1
ATGAATTCTGCCGGGCGGTGGCCACCCGCCAAGGCCACGCGAAACCCGCACGGAGTCGAAGTGAAGGAAGTTCTT
TTCTTCGAAGGCAAATTCCCACAGCTTCATTCCATCTCGTTTTTTACCCACATTTTCTCGATCTTTCTCATCTTT
CTCTCAAACCCTCCACATCTCCCTCTCCGCGCCATCAGAACCGAGAACTCTTTCTCACTTCACCTATACTTCCCG
CTTTTCCGCAATCTCAAAGCGCCTCGCTTTTTTTTGGTTCTTTACGTGATTTCCTTCTATCCTCTTCAATTGCTT
GCATTGGTGCTGCGTTTATTTCGCATCTCAAGCGAGGGAAACACGACAATTCCATTTTTAGAACGTTCATCGCTT
TCTTCTTCATAA
Gene >Pro_DTO377G3_2|g7453.t1
ATGAATTCTGCCGGGCGGTGGCCACCCGCCAAGGCCACGCGAAACCCGCACGGAGTCGAAGTGAAGGAAGTTCTT
TTCTTCGAAGGCAAATTCCCACAGCTTCATTCCATCTCGTTTTTTGTTTCCCCATTTTCTACCTGACTCTCCACG
CCTCACTGTTCATCTTCCTAGACCCACATTTTCTCGATCTTTCTCATCTTTCTCTCAAACCCTCCACATCTCCCT
CTCCGCGCCATCAGAACCGAGAACTCTTTCTCACTTCACCTATACTTCCCGCTTTTCCGCAATCTCAAAGCGCCT
CGCTTTTTTTTGGTTCTTTACGTGATTTCCTTCTATCCTCTTCAATTGCTTGCATTGGTGCTGCGTTTATTTCGC
ATCGTGAGTCCCGATCTCCCATGCCCAAGTCAAGACCTTGAAATTAATGAACATGCAGTCAAGCGAGGGAAACAC
GACAATTCCATTTTTAGAACGTTCATCGCTTTCTTCTTCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail