Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7449.t1
Gene name
Locationscaffold_23:205346..206787
Strand+
Gene length (bp)1441
Transcript length (bp)1131
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05462 Dicty_CAR Slime mold cyclic AMP receptor 8.8E-09 18 181
PF11710 Git3 G protein-coupled glucose receptor regulating Gpa2 9.4E-07 5 187
PF00002 7tm_2 7 transmembrane receptor (Secretin family) 1.4E-06 14 199

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0004930 G protein-coupled receptor activity Yes
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0044425 membrane part No
GO:0060089 molecular transducer activity No
GO:0050794 regulation of cellular process No
GO:0065007 biological regulation No
GO:0007165 signal transduction No
GO:0005575 cellular_component No
GO:0004888 transmembrane signaling receptor activity No
GO:0050789 regulation of biological process No
GO:0038023 signaling receptor activity No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 20 39 19
2 46 68 22
3 83 105 22
4 118 140 22
5 164 186 22
6 314 336 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7449.t1
MTLSEQQILAISATERVCSTVSLVGTFVIVATFIWSPTFRKPINRLVFYASWGNMMANIATIISADGIHSGVDSS
LCQFQGFLIQWFMPADALWTFAMACNVYLTFFHKYDSEQLRRLEWKYVLCCYGVPFVPAFAYFFIQTQARGRIYG
SALLWCWISVQWSFLRIAIFYGPVWLIISLTFAIYLRAGTVIYQKRRQLRNLGGIDSDLVPESPFAMLTGIQVTR
EIACFTPERRSLSEGDASGLPSNAFRAYSVTIEGGSTANTLQKSSSKTDSSPLQQENFGKTGRPDGADSQRRSTS
TEASSATWAYTKYAMLFFIALLVTWVPSTINRVYSLARPNNFNFNAYARGAYPVRRRIYNLSIYGKTLKARVLLF
W*
Coding >Pro_DTO377G3_2|g7449.t1
ATGACGCTGTCAGAACAACAAATATTAGCCATCTCGGCTACAGAGCGTGTTTGCTCGACTGTCTCCCTTGTTGGC
ACTTTCGTTATAGTCGCTACTTTTATTTGGTCCCCCACATTCCGTAAACCCATCAACCGCTTGGTGTTCTATGCA
TCATGGGGTAACATGATGGCTAATATAGCCACCATCATATCGGCAGACGGGATTCATTCTGGGGTTGATAGTTCC
CTGTGCCAGTTTCAAGGGTTTTTGATTCAATGGTTCATGCCCGCCGATGCACTATGGACTTTTGCAATGGCATGC
AATGTTTACCTAACATTCTTCCACAAATACGACTCGGAGCAACTACGTCGGCTCGAATGGAAATATGTGCTCTGC
TGTTACGGTGTTCCATTCGTCCCAGCTTTCGCATACTTCTTCATCCAGACCCAAGCTCGGGGCCGAATATATGGC
TCCGCCCTCCTCTGGTGCTGGATCTCTGTACAGTGGTCCTTCCTCCGCATCGCTATCTTCTACGGACCAGTCTGG
CTCATTATCTCATTGACCTTCGCCATCTATTTACGAGCAGGGACGGTGATTTACCAGAAACGGCGCCAGCTTCGG
AACCTCGGCGGCATTGACTCAGATCTTGTCCCAGAATCTCCCTTTGCTATGTTGACTGGCATTCAAGTTACCAGG
GAGATTGCCTGTTTCACTCCAGAGCGCCGGTCCTTGTCGGAGGGCGACGCGAGCGGGTTGCCGTCTAATGCGTTC
AGAGCATACTCGGTCACGATCGAGGGCGGTAGTACAGCCAACACGCTTCAAAAGTCCAGCTCAAAAACCGATTCC
AGCCCTCTTCAGCAGGAGAATTTTGGCAAGACTGGGCGGCCGGATGGGGCAGACTCACAGCGGAGGTCGACGTCC
ACAGAAGCTAGTTCAGCAACGTGGGCATATACAAAATACGCTATGCTGTTCTTCATTGCATTGCTTGTTACATGG
GTCCCCTCAACGATAAACAGAGTCTATTCCCTGGCTCGTCCTAACAACTTTAATTTTAACGCGTATGCTCGTGGC
GCATATCCCGTTCGGCGACGAATATACAATCTTTCAATCTACGGAAAGACTCTCAAAGCCCGAGTCCTGCTCTTT
TGGTGA
Transcript >Pro_DTO377G3_2|g7449.t1
ATGACGCTGTCAGAACAACAAATATTAGCCATCTCGGCTACAGAGCGTGTTTGCTCGACTGTCTCCCTTGTTGGC
ACTTTCGTTATAGTCGCTACTTTTATTTGGTCCCCCACATTCCGTAAACCCATCAACCGCTTGGTGTTCTATGCA
TCATGGGGTAACATGATGGCTAATATAGCCACCATCATATCGGCAGACGGGATTCATTCTGGGGTTGATAGTTCC
CTGTGCCAGTTTCAAGGGTTTTTGATTCAATGGTTCATGCCCGCCGATGCACTATGGACTTTTGCAATGGCATGC
AATGTTTACCTAACATTCTTCCACAAATACGACTCGGAGCAACTACGTCGGCTCGAATGGAAATATGTGCTCTGC
TGTTACGGTGTTCCATTCGTCCCAGCTTTCGCATACTTCTTCATCCAGACCCAAGCTCGGGGCCGAATATATGGC
TCCGCCCTCCTCTGGTGCTGGATCTCTGTACAGTGGTCCTTCCTCCGCATCGCTATCTTCTACGGACCAGTCTGG
CTCATTATCTCATTGACCTTCGCCATCTATTTACGAGCAGGGACGGTGATTTACCAGAAACGGCGCCAGCTTCGG
AACCTCGGCGGCATTGACTCAGATCTTGTCCCAGAATCTCCCTTTGCTATGTTGACTGGCATTCAAGTTACCAGG
GAGATTGCCTGTTTCACTCCAGAGCGCCGGTCCTTGTCGGAGGGCGACGCGAGCGGGTTGCCGTCTAATGCGTTC
AGAGCATACTCGGTCACGATCGAGGGCGGTAGTACAGCCAACACGCTTCAAAAGTCCAGCTCAAAAACCGATTCC
AGCCCTCTTCAGCAGGAGAATTTTGGCAAGACTGGGCGGCCGGATGGGGCAGACTCACAGCGGAGGTCGACGTCC
ACAGAAGCTAGTTCAGCAACGTGGGCATATACAAAATACGCTATGCTGTTCTTCATTGCATTGCTTGTTACATGG
GTCCCCTCAACGATAAACAGAGTCTATTCCCTGGCTCGTCCTAACAACTTTAATTTTAACGCGTATGCTCGTGGC
GCATATCCCGTTCGGCGACGAATATACAATCTTTCAATCTACGGAAAGACTCTCAAAGCCCGAGTCCTGCTCTTT
TGGTGA
Gene >Pro_DTO377G3_2|g7449.t1
ATGACGCTGTCAGAACAACAAATATTAGCCATCTCGGCTACAGAGCGTGTTTGCTCGACTGTCTCCCTTGTTGGC
ACTTTCGTTATAGTCGCTACTTTTATTTGGTCCCCCACATTCCGTAAACCCATCAACCGCTTGGTGTTCTATGCA
TCATGGGGTAACATGATGGCTAATATAGCCACCATCATATCGGCAGACGGGATTCATTCTGGGGTTGATAGTTCC
CTGTGCCAGTTTCAAGGGTTTTTGATTCAATGGTTCGTATCAAATCGGAACTAACACCATTAGCAGATGGCCACT
AATAAGCAAGGATGCATAGGTTCATGCCCGCCGATGCACTATGGACTTTTGCAATGGCATGCAATGTTTACCTAA
CATTCTTCCACAAATACGACTCGGAGCAACTACGTCGGCTCGAATGGAAATATGTGCTCTGCTGTTACGGTGTTC
CATTCGTCCCAGCTTTCGCATACTTCTTCATCCAGACCCAAGCTCGGGGCCGAATATATGGCTCCGCCCTCGTGA
GCAGAACCCCAAAGTCCTCCCTTCTATCACCCTATGCTAATCCAATCATCCACCGACAGCTCTGGTGCTGGATCT
CTGTACAGTGGTCCTTCCTCCGCATCGCTATCTTCTACGGACCAGTCTGGCTCATTATCTCATTGACCTTCGCCA
TCTATTTACGAGCAGGGACGGTGATTTACCAGAAACGGCGCCAGCTTCGGAACCTCGGCGGCATTGACTCAGATC
TTGTCCCAGAATCTCCCTTTGCTATGTTGACTGGCATTCAAGTTACCAGGGAGATTGCCTGTTTCACTCCAGAGC
GCCGGTCCTTGTCGGAGGGCGACGCGAGCGGGTTGCCGTCTAATGCGTTCAGAGCATACTCGGTCACGATCGAGG
GCGGTAGTACAGCCAACACGCTTCAAAAGTCCAGCTCAAAAACCGATTCCAGCCCTCTTCAGCAGGAGAATTTTG
GCAAGACTGGGCGGCCGGATGGGGCAGACTCACAGCGGAGGTCGACGTCCACAGAAGCTAGTTCAGCAACGTGGG
CATATACAAAATACGCTATGCTGTTCTTCATTGCATTGCTTGTTACATGGGTAGGTCTAATTGAAGCCCATTATA
ATCTAAAAACTGCTGTCGGTTCTTTGTGTTGATTGTTCGACACTGCAGGTCCCCTCAACGATAAACAGAGTCTAT
TCCCTGGCTCGTCCTAACAACTTTAATTTTAGTCTGAACTATGCATCTAGCTTTGTCCTTCCCCTCCAGGGATTT
TGGAACAGCCTTATATACGTCTCTATCTCATGGCCCGCATTCAAATTACTTTGGTCTGACCTCTATAGACGCGTA
TGCTCGTGGCGCATATCCCGTTCGGCGACGAATATACAATCTTTCAATCTACGGAAAGACTCTCAAAGCCCGAGT
CCTGCTCTTTTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail