Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7442.t1
Gene name
Locationscaffold_23:187072..189035
Strand+
Gene length (bp)1963
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.4E-11 389 458
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.2E-06 519 573

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 63.90 38.83 88.96
5d_25C Five days - 25 degrees Celsius 70.29 43.17 97.40
7d_25C Seven days - 25 degrees Celsius 81.11 49.86 112.35
10d_25C Ten days - 25 degrees Celsius 107.16 65.42 148.90
7d_15C Seven days - 15 degrees Celsius 75.80 46.56 105.05
7d_30C Seven days - 30 degrees Celsius 77.63 47.63 107.63

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.742207 no
3d_25C 7d_25C 0.313756 no
3d_25C 7d_15C 0.503526 no
3d_25C 7d_30C 0.428964 no
3d_25C 10d_25C 0.013513 yes
5d_25C 7d_25C 0.583798 no
5d_25C 7d_15C 0.795519 no
5d_25C 7d_30C 0.719830 no
5d_25C 10d_25C 0.038184 yes
7d_25C 7d_15C 0.824791 no
7d_25C 7d_30C 0.892335 no
7d_25C 10d_25C 0.221744 no
7d_15C 7d_30C 0.943264 no
7d_15C 10d_25C 0.107149 no
7d_30C 10d_25C 0.142592 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7442.t1
MNGDTYSSRETGRSRDYFRDERRDRDRGDRPERGAERPADRGAERGAERGTERGAERGDRSDRGERRRSRSPHHG
SRREREVNSYSTSRDYRAREREDRYSGRRDDREWDRGDRAERGDRAERGGGDRGGGDRGGGDRGGGDRGGGRRRD
FDERPRRDLFDDRRGGRGGGDRGDRGDRERRDRKRSATPPRRKEPTPDLTDVPSVLTRKRRLTQWDMKPPGYENV
TAEQAKISGMFPLPGAPRQQPMDPSRMKDFLNPPTGDSDNAALKPSNSRQSKRLFVYNIPSGVSGDAVITFFNLQ
LNGLNVIHNVDPCISAQVSEDKTFALLEFKDPNDATVALAFDGITMAESGDKGLEVRRPKDYIVPDGSASQPVQP
DVVLSEVPDSPNKICISNIPTYINEEAIIMLLKSFGDLKSFVLVKDAATEESRGIAFYEYVDPNNTALAVEGLNG
MELVDHHLKFALASVGTTQASGLDMGVNAMQMFAKTTSQDLETTQVLQLLNMVTLDELLNDEDYEEIMEDVSEEC
AKFGKILGMKIPRRGHGAGKIFIKYDTAESATTALKALAGRKFSDRTVVASYFGVENFDTEAW*
Coding >Pro_DTO377G3_2|g7442.t1
ATGAACGGTGACACCTACTCATCCAGAGAGACTGGACGTTCCCGCGACTACTTCCGCGACGAGCGGCGTGATCGA
GACCGGGGTGACAGACCCGAACGCGGAGCTGAGCGACCTGCCGACCGAGGTGCTGAGCGTGGTGCCGAACGAGGA
ACCGAGCGTGGAGCTGAACGGGGCGATAGGAGTGATCGCGGTGAACGACGCCGTTCGCGTTCGCCTCATCATGGA
TCTCGTCGGGAGCGCGAAGTGAACTCGTACTCAACCAGCCGTGACTACCGTGCCCGTGAGCGCGAAGACCGCTAC
TCTGGCCGCCGTGATGATCGAGAGTGGGACCGTGGCGACCGTGCCGAGCGAGGTGACCGCGCTGAGCGTGGGGGT
GGTGACCGTGGTGGTGGTGATCGTGGGGGTGGTGACCGTGGTGGTGGAGATCGCGGTGGTGGTCGTCGACGTGAC
TTTGACGAAAGACCCCGTCGCGACTTGTTTGACGACCGACGCGGTGGACGTGGTGGCGGTGACCGTGGTGACCGT
GGAGACCGTGAGAGAAGAGACCGCAAGCGAAGCGCCACGCCCCCGCGGCGCAAGGAGCCTACCCCCGATTTGACA
GATGTGCCCTCGGTGTTGACCCGTAAACGTCGTTTGACTCAATGGGACATGAAGCCTCCTGGTTATGAGAATGTT
ACGGCTGAACAGGCAAAGATCTCAGGGATGTTCCCTCTTCCCGGAGCTCCTCGTCAGCAGCCGATGGACCCCAGC
CGCATGAAGGACTTCCTGAACCCTCCCACTGGCGATAGCGACAATGCTGCCCTCAAGCCTTCTAACTCTCGTCAA
TCAAAGCGTCTTTTCGTTTACAACATCCCGTCCGGTGTCTCGGGCGATGCCGTTATTACCTTCTTCAATCTTCAA
TTGAATGGACTCAATGTTATTCACAATGTCGATCCCTGCATCTCTGCCCAAGTTTCTGAAGATAAAACATTCGCG
CTCCTGGAGTTCAAGGATCCAAATGACGCCACAGTCGCATTGGCTTTCGATGGAATTACCATGGCGGAGAGTGGA
GACAAGGGACTTGAAGTGCGACGGCCAAAGGACTACATTGTTCCCGACGGGAGCGCATCGCAGCCAGTACAGCCG
GACGTCGTTCTGAGCGAGGTGCCTGACTCACCCAACAAGATCTGCATCTCTAATATTCCAACCTACATCAACGAG
GAAGCTATTATCATGTTGCTCAAGTCATTCGGCGACCTTAAGTCATTTGTCTTGGTCAAGGATGCTGCTACAGAG
GAGTCTCGGGGAATTGCCTTTTATGAATACGTCGACCCGAACAACACTGCGCTTGCCGTTGAAGGTTTGAACGGC
ATGGAACTAGTCGATCACCACCTTAAGTTTGCTCTCGCCAGCGTTGGAACCACACAAGCCTCTGGCCTCGACATG
GGCGTGAATGCCATGCAGATGTTCGCCAAGACGACCTCCCAGGATCTAGAGACCACCCAGGTCCTGCAGCTTCTC
AACATGGTCACGCTTGACGAGCTCCTCAATGACGAAGATTACGAAGAAATCATGGAGGATGTGAGCGAGGAATGC
GCCAAGTTCGGAAAGATTCTCGGGATGAAGATCCCCCGCCGTGGACACGGCGCTGGTAAAATCTTCATTAAGTAC
GATACCGCTGAATCCGCCACCACCGCTCTCAAAGCGCTGGCGGGTCGCAAGTTCTCTGACCGTACAGTTGTTGCC
TCATACTTCGGCGTTGAGAACTTCGACACCGAGGCCTGGTAA
Transcript >Pro_DTO377G3_2|g7442.t1
ATGAACGGTGACACCTACTCATCCAGAGAGACTGGACGTTCCCGCGACTACTTCCGCGACGAGCGGCGTGATCGA
GACCGGGGTGACAGACCCGAACGCGGAGCTGAGCGACCTGCCGACCGAGGTGCTGAGCGTGGTGCCGAACGAGGA
ACCGAGCGTGGAGCTGAACGGGGCGATAGGAGTGATCGCGGTGAACGACGCCGTTCGCGTTCGCCTCATCATGGA
TCTCGTCGGGAGCGCGAAGTGAACTCGTACTCAACCAGCCGTGACTACCGTGCCCGTGAGCGCGAAGACCGCTAC
TCTGGCCGCCGTGATGATCGAGAGTGGGACCGTGGCGACCGTGCCGAGCGAGGTGACCGCGCTGAGCGTGGGGGT
GGTGACCGTGGTGGTGGTGATCGTGGGGGTGGTGACCGTGGTGGTGGAGATCGCGGTGGTGGTCGTCGACGTGAC
TTTGACGAAAGACCCCGTCGCGACTTGTTTGACGACCGACGCGGTGGACGTGGTGGCGGTGACCGTGGTGACCGT
GGAGACCGTGAGAGAAGAGACCGCAAGCGAAGCGCCACGCCCCCGCGGCGCAAGGAGCCTACCCCCGATTTGACA
GATGTGCCCTCGGTGTTGACCCGTAAACGTCGTTTGACTCAATGGGACATGAAGCCTCCTGGTTATGAGAATGTT
ACGGCTGAACAGGCAAAGATCTCAGGGATGTTCCCTCTTCCCGGAGCTCCTCGTCAGCAGCCGATGGACCCCAGC
CGCATGAAGGACTTCCTGAACCCTCCCACTGGCGATAGCGACAATGCTGCCCTCAAGCCTTCTAACTCTCGTCAA
TCAAAGCGTCTTTTCGTTTACAACATCCCGTCCGGTGTCTCGGGCGATGCCGTTATTACCTTCTTCAATCTTCAA
TTGAATGGACTCAATGTTATTCACAATGTCGATCCCTGCATCTCTGCCCAAGTTTCTGAAGATAAAACATTCGCG
CTCCTGGAGTTCAAGGATCCAAATGACGCCACAGTCGCATTGGCTTTCGATGGAATTACCATGGCGGAGAGTGGA
GACAAGGGACTTGAAGTGCGACGGCCAAAGGACTACATTGTTCCCGACGGGAGCGCATCGCAGCCAGTACAGCCG
GACGTCGTTCTGAGCGAGGTGCCTGACTCACCCAACAAGATCTGCATCTCTAATATTCCAACCTACATCAACGAG
GAAGCTATTATCATGTTGCTCAAGTCATTCGGCGACCTTAAGTCATTTGTCTTGGTCAAGGATGCTGCTACAGAG
GAGTCTCGGGGAATTGCCTTTTATGAATACGTCGACCCGAACAACACTGCGCTTGCCGTTGAAGGTTTGAACGGC
ATGGAACTAGTCGATCACCACCTTAAGTTTGCTCTCGCCAGCGTTGGAACCACACAAGCCTCTGGCCTCGACATG
GGCGTGAATGCCATGCAGATGTTCGCCAAGACGACCTCCCAGGATCTAGAGACCACCCAGGTCCTGCAGCTTCTC
AACATGGTCACGCTTGACGAGCTCCTCAATGACGAAGATTACGAAGAAATCATGGAGGATGTGAGCGAGGAATGC
GCCAAGTTCGGAAAGATTCTCGGGATGAAGATCCCCCGCCGTGGACACGGCGCTGGTAAAATCTTCATTAAGTAC
GATACCGCTGAATCCGCCACCACCGCTCTCAAAGCGCTGGCGGGTCGCAAGTTCTCTGACCGTACAGTTGTTGCC
TCATACTTCGGCGTTGAGAACTTCGACACCGAGGCCTGGTAA
Gene >Pro_DTO377G3_2|g7442.t1
ATGAACGGTGACACCTACTCATCCAGAGGTAAGTATCCTTACATTAACTTCTGGTATAACTGCTAATATCCCCAA
GAGACTGGACGTTCCCGCGACTACTTCGTAAGTATCAGCCAATCTTTGGTCGCAACCGCGGCGATTAACCCCAAT
TCTAGCGCGACGAGCGGCGTGATCGAGACCGGGGTGACAGACCCGAACGCGGAGCTGAGCGACCTGCCGACCGAG
GTGCTGAGCGTGGTGCCGAACGAGGAACCGAGCGTGGAGCTGAACGGGGCGATAGGAGTGATCGCGGTGAACGAC
GCCGTTCGCGTTCGCCTCATCATGGATCTCGTCGGGAGCGCGAAGTGAACTCGTACTCAACCAGCCGTGACTACC
GTGCCCGTGAGCGCGAAGACCGCTACTCTGGCCGCCGTGATGATCGAGAGTGGGACCGTGGCGACCGTGCCGAGC
GAGGTGACCGCGCTGAGCGTGGGGGTGGTGACCGTGGTGGTGGTGATCGTGGGGGTGGTGACCGTGGTGGTGGAG
ATCGCGGTGGTGGTCGTCGACGTGACTTTGACGAAAGACCCCGTCGCGACTTGTTTGACGACCGACGCGGTGGAC
GTGGTGGCGGTGACCGTGGTGACCGTGGAGACCGTGAGAGAAGAGACCGCAAGCGAAGCGCCACGCCCCCGCGGC
GCAAGGAGCCTACCCCCGATTTGACAGATGTGCCCTCGGTGTTGACCCGTAAACGTCGTTTGACTCAATGGGACA
TGAAGCCTCCTGGTTATGAGAATGTTACGGCTGAACAGGCAAAGATCTCAGGTATGTGTTTAAAGCTTATGAGCT
AGTGGAACCGTCTAACATCAACAGGGATGTTCCCTCTTCCCGGAGCTCCTCGTCAGCAGCCGATGGACCCCAGCC
GCATGAAGGACTTCCTGAACCCTCCCACTGGCGATAGCGACAATGCTGCCCTCAAGCCTTCTAACTCTCGTCAAT
CAAAGCGTCTTTTCGTTTACAACATCCCGTCCGGTGTCTCGGGCGATGCCGTTATTACCTTCTTCAATCTTCAAT
TGAATGGACTCAATGTTATTCACAATGTCGATCCCTGCATCTCTGCCCAAGTTTCTGAAGATAAAACATTCGCGC
TCCTGGAGTTCAAGGATCCAAATGACGCCACAGTCGCATTGGCTTTCGATGGAATTACCATGGCGGAGAGTGGAG
ACAAGGGACTTGAAGTGCGACGGCCAAAGGACTACATTGTTCCCGACGGGAGCGCATCGCAGCCAGTACAGCCGG
ACGTCGTTCTGAGCGAGGTGCCTGACTCACCCAACAAGATCTGCATCTCTAATATTCCAACCTACATCAACGAGG
AAGCTATTATCATGTTGCTCAAGTCATTCGGCGACCTTAAGTCATTTGTCTTGGTCAAGGATGCTGCTACAGAGG
AGTCTCGGGTAAGTTGAGTATTTCCCTACCGTCAAATTCTTTCTAACTTTTCCAGGGAATTGCCTTTTATGAATA
CGTCGACCCGAACAACACTGCGCTTGCCGTTGAAGGTTTGAACGGCATGGAACTAGTCGATCACCACCTTAAGTT
TGCTCTCGCCAGCGTTGGAACCACACAAGCCTCTGGCCTCGACATGGGCGTGAATGCCATGCAGATGTTCGCCAA
GACGACCTCCCAGGATCTAGAGACCACCCAGGTCCTGCAGCTTCTCAACATGGTCACGCTTGACGAGCTCCTCAA
TGACGAAGATTACGAAGAAATCATGGAGGATGTGAGCGAGGAATGCGCCAAGTTCGGAAAGATTCTCGGGATGAA
GATCCCCCGCCGTGGACACGGCGCTGGTAAAATCTTCATTAAGTACGATACCGCTGAATCCGCCACCACCGCTCT
CAAAGCGCTGGCGGGTCGCAAGTTCTCTGACCGTACAGTTGTTGCCTCATACTTCGGCGTTGAGAACTTCGACAC
CGAGGCCTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail