Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7441.t1
Gene name
Locationscaffold_23:185542..186896
Strand-
Gene length (bp)1354
Transcript length (bp)1245
Coding sequence length (bp)1245
Protein length (aa) 415

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07934 OGG_N 8-oxoguanine DNA glycosylase, N-terminal domain 5.3E-36 11 127
PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein 7.6E-14 128 292

GO

GO Term Description Terminal node
GO:0003684 damaged DNA binding Yes
GO:0006284 base-excision repair Yes
GO:0008534 oxidized purine nucleobase lesion DNA N-glycosylase activity Yes
GO:0006289 nucleotide-excision repair Yes
GO:0003824 catalytic activity No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0006950 response to stress No
GO:0033554 cellular response to stress No
GO:0044260 cellular macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006281 DNA repair No
GO:0071704 organic substance metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0050896 response to stimulus No
GO:0005488 binding No
GO:0006259 DNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0019104 DNA N-glycosylase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0051716 cellular response to stimulus No
GO:0008150 biological_process No
GO:0140097 catalytic activity, acting on DNA No
GO:0000702 oxidized base lesion DNA N-glycosylase activity No
GO:0016787 hydrolase activity No
GO:0003677 DNA binding No
GO:0016799 hydrolase activity, hydrolyzing N-glycosyl compounds No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7441.t1
MSLGVLSEWQKLPLSLSELCINTTLRCGQSFRWRNFPESQEWRCVLYGHLLSLKQDSNFLYYRSVQPPSHAFTDN
DHLIRIIKHYFNLTPNLTELYSQWSSQDPNFKKKAAQFTGIRILRQDAWEALVSFICSSNNNIARISQMVEKLCI
HYGKPVATIEGRAYHDFPPPGALTGKDVESNLRNLGFGYRAKYIYQTAVMVSNREQGWLDSLSNPECPAFGVDPK
PSGEMKPEGREGYREAHEKLLELQGVGPKVSDCVSLMGLGWGESVPVDTHVWQIAQRDYRFGKSSNKNLNKTTYD
AVANHFRKLWGKEAGWAHSVLFTADLRTFADKLAATKKVEVKVKDEESDVKVETKVTTALSLKVSKEENVDVKVK
VEDIDDAKKPRDKKRKETENIIPVVQTTETRRMSKRLKR*
Coding >Pro_DTO377G3_2|g7441.t1
ATGTCTCTAGGTGTTTTGTCAGAATGGCAGAAGCTGCCTTTGAGCTTGAGTGAGCTTTGCATCAATACTACGCTC
AGATGCGGCCAGTCTTTTAGATGGCGGAACTTTCCAGAGAGTCAGGAATGGCGATGCGTTCTCTATGGCCATCTT
CTGTCGCTGAAGCAAGACTCAAACTTCTTGTACTATAGATCTGTGCAACCTCCTTCCCATGCATTCACCGACAAT
GATCATCTCATCCGCATTATCAAACATTACTTCAACCTAACGCCAAATTTGACTGAACTCTACTCTCAATGGTCA
TCACAAGACCCCAATTTCAAGAAGAAGGCTGCGCAATTCACCGGGATCAGGATCCTTCGACAAGATGCATGGGAA
GCATTGGTATCATTTATCTGCAGCAGCAACAATAATATTGCACGGATCTCACAAATGGTGGAGAAGTTATGCATA
CATTATGGAAAGCCCGTGGCCACAATTGAAGGGCGTGCATATCATGATTTTCCTCCCCCAGGCGCATTGACTGGC
AAGGATGTGGAAAGCAATCTGCGCAATTTAGGATTTGGATACCGGGCTAAATACATATACCAAACTGCGGTTATG
GTATCCAACCGAGAGCAGGGCTGGCTAGATAGCTTGAGCAACCCCGAGTGTCCAGCATTTGGCGTGGATCCTAAA
CCAAGCGGCGAAATGAAACCAGAAGGGCGAGAGGGATATCGTGAAGCTCATGAAAAGCTTCTTGAGCTACAGGGA
GTTGGGCCAAAAGTGTCAGACTGTGTCAGTTTGATGGGATTAGGCTGGGGAGAGTCCGTGCCGGTTGATACTCAT
GTGTGGCAAATCGCACAGCGAGATTACCGTTTTGGAAAAAGCTCCAATAAGAACTTGAACAAGACGACTTATGAT
GCTGTTGCCAATCATTTCCGCAAGCTTTGGGGTAAGGAAGCTGGATGGGCCCATAGTGTGCTTTTCACTGCGGAC
CTGCGGACCTTTGCAGACAAACTTGCTGCAACTAAGAAAGTTGAGGTGAAGGTGAAAGACGAAGAGTCTGATGTC
AAGGTTGAGACAAAAGTGACAACTGCTCTCTCTTTGAAGGTTTCTAAGGAGGAAAACGTCGATGTGAAAGTCAAG
GTCGAAGACATAGATGATGCCAAGAAGCCCAGGGACAAGAAGAGAAAGGAGACTGAGAACATTATTCCTGTTGTT
CAAACAACAGAGACACGGAGAATGTCCAAGAGACTAAAGCGTTGA
Transcript >Pro_DTO377G3_2|g7441.t1
ATGTCTCTAGGTGTTTTGTCAGAATGGCAGAAGCTGCCTTTGAGCTTGAGTGAGCTTTGCATCAATACTACGCTC
AGATGCGGCCAGTCTTTTAGATGGCGGAACTTTCCAGAGAGTCAGGAATGGCGATGCGTTCTCTATGGCCATCTT
CTGTCGCTGAAGCAAGACTCAAACTTCTTGTACTATAGATCTGTGCAACCTCCTTCCCATGCATTCACCGACAAT
GATCATCTCATCCGCATTATCAAACATTACTTCAACCTAACGCCAAATTTGACTGAACTCTACTCTCAATGGTCA
TCACAAGACCCCAATTTCAAGAAGAAGGCTGCGCAATTCACCGGGATCAGGATCCTTCGACAAGATGCATGGGAA
GCATTGGTATCATTTATCTGCAGCAGCAACAATAATATTGCACGGATCTCACAAATGGTGGAGAAGTTATGCATA
CATTATGGAAAGCCCGTGGCCACAATTGAAGGGCGTGCATATCATGATTTTCCTCCCCCAGGCGCATTGACTGGC
AAGGATGTGGAAAGCAATCTGCGCAATTTAGGATTTGGATACCGGGCTAAATACATATACCAAACTGCGGTTATG
GTATCCAACCGAGAGCAGGGCTGGCTAGATAGCTTGAGCAACCCCGAGTGTCCAGCATTTGGCGTGGATCCTAAA
CCAAGCGGCGAAATGAAACCAGAAGGGCGAGAGGGATATCGTGAAGCTCATGAAAAGCTTCTTGAGCTACAGGGA
GTTGGGCCAAAAGTGTCAGACTGTGTCAGTTTGATGGGATTAGGCTGGGGAGAGTCCGTGCCGGTTGATACTCAT
GTGTGGCAAATCGCACAGCGAGATTACCGTTTTGGAAAAAGCTCCAATAAGAACTTGAACAAGACGACTTATGAT
GCTGTTGCCAATCATTTCCGCAAGCTTTGGGGTAAGGAAGCTGGATGGGCCCATAGTGTGCTTTTCACTGCGGAC
CTGCGGACCTTTGCAGACAAACTTGCTGCAACTAAGAAAGTTGAGGTGAAGGTGAAAGACGAAGAGTCTGATGTC
AAGGTTGAGACAAAAGTGACAACTGCTCTCTCTTTGAAGGTTTCTAAGGAGGAAAACGTCGATGTGAAAGTCAAG
GTCGAAGACATAGATGATGCCAAGAAGCCCAGGGACAAGAAGAGAAAGGAGACTGAGAACATTATTCCTGTTGTT
CAAACAACAGAGACACGGAGAATGTCCAAGAGACTAAAGCGTTGA
Gene >Pro_DTO377G3_2|g7441.t1
ATGTCTCTAGGTGTTTTGTCAGAATGGCAGAAGCTGCCTTTGAGCTTGAGTGAGCTTTGCATCAATACTACGCTC
AGATGCGGCCAGTCTTTTAGGTTTGTCAGCCAAGTTTCCGGGTCCGGGGATTGTAGATCAAGCGACTGACCCTTT
TTAGATGGCGGAACTTTCCAGAGAGTCAGGAATGGCGATGCGTTCTCTATGGCCATCTTCTGTCGCTGAAGCAAG
ACTCAAACTTCTTGTACTATAGATCTGTGCAACCTCCTTCCCATGCATTCACCGACAATGATCATCTCATCCGCA
TTATCAAACATTACTTCAACCTAACGCCAAATTTGACTGAACTCTACTCTCAATGGTCATCACAAGACCCCAATT
TCAAGAAGAAGGCTGCGCAATTCACCGGGATCAGGATCCTTCGACAAGATGCATGGGAAGCATTGGTATCATTTA
TCTGCAGCAGCAACAATAATATTGCACGGATCTCACAAATGGTGGAGAAGTTATGCATACATTATGGAAAGCCCG
TGGCCACAATTGAAGGGCGTGCATATCATGATTTTCCTCCCCCAGGCGCATTGACTGGCAAGGATGTGGAAAGCA
ATCTGCGCAATTTAGGATTTGGATACCGGGCTAAATACATATACCAAACTGCGGTTATGGTATCCAACCGAGAGC
AGGGCTGGCTAGATAGCTTGAGCAACCCCGAGTGTCCAGCATTTGGCGTGGATCCTAAACCAAGCGGCGAAATGA
AACCAGAAGGGCGAGAGGGATATCGTGAAGCTCATGAAAAGCTTCTTGAGCTACAGGGAGTTGGGCCAAAAGTGT
CAGACTGTGTCAGTTTGATGGGATTAGGCTGGGGAGAGTCCGTGCCGGTTGATACTCATGGTGAGTTCTTTTGAT
AATGTTTCTGATTTATCTCTAATCCTTTACGATAGTGTGGCAAATCGCACAGCGAGATTACCGTTTTGGAAAAAG
CTCCAATAAGAACTTGAACAAGACGACTTATGATGCTGTTGCCAATCATTTCCGCAAGCTTTGGGGTAAGGAAGC
TGGATGGGCCCATAGTGTGCTTTTCACTGCGGACCTGCGGACCTTTGCAGACAAACTTGCTGCAACTAAGAAAGT
TGAGGTGAAGGTGAAAGACGAAGAGTCTGATGTCAAGGTTGAGACAAAAGTGACAACTGCTCTCTCTTTGAAGGT
TTCTAAGGAGGAAAACGTCGATGTGAAAGTCAAGGTCGAAGACATAGATGATGCCAAGAAGCCCAGGGACAAGAA
GAGAAAGGAGACTGAGAACATTATTCCTGTTGTTCAAACAACAGAGACACGGAGAATGTCCAAGAGACTAAAGCG
TTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail