Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g744.t1
Gene name
Locationscaffold_01:1907886..1915460
Strand+
Gene length (bp)7574
Transcript length (bp)7272
Coding sequence length (bp)7272
Protein length (aa) 2424

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14765 PS-DH Polyketide synthase dehydratase 2.6E-65 876 1156
PF00698 Acyl_transf_1 Acyl transferase domain 2.5E-57 505 828
PF08659 KR KR domain 1.4E-57 2039 2216
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 8.1E-30 14 177
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 5.1E-14 179 240
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 7.6E-30 249 364
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 4.7E-24 368 482
PF08242 Methyltransf_12 Methyltransferase domain 3.5E-17 1327 1431
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 5.7E-15 1836 1942
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 2.1E-12 1877 2011
PF13489 Methyltransf_23 Methyltransferase domain 2.3E-11 1311 1482
PF13649 Methyltransf_25 Methyltransferase domain 2.7E-09 1326 1429
PF00106 adh_short short chain dehydrogenase 4.6E-08 2042 2198
PF08241 Methyltransf_11 Methyltransferase domain 2.2E-07 1327 1432
PF13847 Methyltransf_31 Methyltransferase domain 3.7E-07 1322 1437
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 4.6E-07 1717 1777
PF00550 PP-binding Phosphopantetheine attachment site 1.0E-04 2354 2401

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008150 biological_process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g744.t1
MILKVVEPKPVPPEPIAICGMSVRLPGGLHTPQQLWDFLVAKGDARGQVPKSRYNVSTYYSETQKPGSVKTEYGY
FLDESIDIASVDTSFFTMGKLEVERMDPQQRQMLEVARECMEDAGETNWKGRPIGCYMGSFGEDWLEICVKETQQ
YGQHRVSGYGDFMLPNRVSYEMDLTGPRGDCESAIVGGANLIMAPGMTAAMSEQGVISPDGSCKSFSADANGYAR
GEGISAIFIKPLADALRDGNPVRAVIRSTSSNSDGRGAGIGAHVPNDVSHEAMIRRAYEVAGITDYSQTAFFECH
GTGTQVGDPIETRAVGRVFGPSGGILIGSVKPNLGHAEGASGITSLIKSVLALENRTIPPNIKFKERNPNIQWDE
YGLAVPTDPMPWPEARSERISVNSFGIGGTNAHVIVDSARSFGVSPVATRHTISPQLLVYSANNAESLKQMISHY
TSYVQKNPARVADLAFTLANKREHLPHRAFSVQSPLGPLTTSAPSKTGETPNIVMVFTGQGAQWPQMGASMIHND
VYPAFKKSIQNLDSHLQTLTDAPDWSIEEELLKDPDTSRLSSSELSQPLCTAIQVALIDTFASVGVQPAAVVGHS
SGEIAAAYAAGAITATEAITIAFYRGQVTKAQTRPGSMAAIGMGAEDIQEYLQDGVVVACENSPKSVTLAGDTHA
IEKVVAIIKEAHPDVLARQLKVDKAYHSHHMAEIGDEYHALIEHEISTKAPNKLFFSSVENELLTEAQHLGPKYW
QMNLQSPVLFRSAVSSIIKHQISKNMVLLEVGPHSALAGPLRQIQSHLSTSSPYISTFVRNQDSTESFLTAIGQL
HVLNAVPALDKVISTGSTLPDLPRYPWDHSKKFWYESRLSKEWRHREHKYHDLLGVRVTESPDFHPLFRNLFHLD
NAPWIRDHKVGDDIVFPFAGYAAMIGEAVRQVTGVREAFKLRNVIVSTALVLNEGPPVEIMTTLHRHRLTDSLDS
EWWEFAITSHNGANWIKHCSGEVRSLNEYLEDVDKKAPLVRKVETRRCYHSMAMSGLNFGPSFQRLDHVRSDTVS
QSATSELVAKDTDGDNYHLHPTVIDASLQLLSVAASKGYAEPITNIMVPTHIQEISIYRCYENVHVQASASYTPN
GSIIGSGQCITAGGKVALRSSGIKLSVLDHQDPEKGEPPIGCAEWAPHIDFLDVNTLIKPLIDRSDYMPALTELS
HLCMIYTQRVIADLDTPISHMYKYRSWIDQHLLSVDLQSLQILDNIAIKQRVKELVDQISQTNGAHLAVGIEVIF
NNVQQIFTGEAEALDLLLTDDILANVYNAMDQCDISEFIRNLTHTKPNLRILEIGAGTGGSTANILKLLTPGSRT
LYMNYTFTDISSGFFVAAKDRFASYPNIEYATLDISKDPSDQGFDDRKYDLILATNVIHATASLNDSLSNIHKLL
SPTGWLLLHELTPISKWINYIFGTLAGWWYGEVDGRSGEPYIGIERWAKELKAAGFRTPDAAVLDSNQPHQLNAM
IVARPEVDIAPKKCVTVLTLSKSMSVGPLLQALDNRGYSVHHSRFDEEPLPEGQDVIALLDEEAPFFEGMDNQRF
DSFKKLAHSLDQRGVLWVTRSSQAQCRDPRFAQINGVARTIRNELRVDFATCEVDDLDVSFEKLIDVYEKFQVRQ
EDETLKPEFEYAIVDNTVQVGRYHPFSAQNGQEALASNSSIALRTSKPGRLASLHWAHGDIKPLEGDEVEIDTYA
IGLNFKDVLCAMGIVEAKENEFGHEGAGIVRRTGPDVQSLKVGDRVMVVGSCLFGTQLVLSENLCEKIPGGLSFS
DAASMPCVFSTSIYSIFDVGNLKKGQSILIHSACGGVGIATIQLAQMVGAEIYATVGNEEKVRYLMDTFGLPRNR
ILNSRNASFVEDIMRETNGQGVDLALNSLSGELLHATWKCIAPFGKMVEIGKRDLIGSGKLDMTPFLDNRSYCCV
DLDQICSRKPILAKKLLKEIVDLLKERYISPIRPIKVFSSDGIHDAFRYMQQGTHLGKIVVSMRDTSGQVSAVQN
IQPRKKPTQLNSSGAYLLVGGLGGLGRAISTWMVQRGARHLIYLSRTAGSSESHREFAQELASMDCRVDFVQGSV
SNIADVTTAVTRAQGRLRGILQMSMMLRDRSFERMTLEEWNTSVDPKVKGTWNLHNASVSANAELDFFVLFSSVS
GVFGLPGQINYAGANTFLDAFSQYRLGLGLPACAIDIGIVEGVGYAAEQDEILQKLKAAGGLGNTVSVSELLSAV
EAAMTSISSNLRPQAGNFGVGIRPNVPLADQRNRLVWKKDIRMSVFHNTGAAGTILTSASDAGAGLEAFITQAKG
DAALINQPGSAQMLAVEIGKKVFSFLLKPEEDLVTSCSLSDLGMDSLVAIEVKQWWKATFGFDISVLELMGMGSL
DILGEHAAHGMLRLFHGVQDQAD*
Coding >Pro_DTO377G3_2|g744.t1
ATGATTCTCAAGGTTGTTGAACCGAAACCGGTTCCCCCAGAGCCAATCGCTATATGTGGAATGTCTGTACGTCTC
CCTGGAGGCCTACACACACCCCAACAGCTATGGGACTTCCTGGTTGCCAAAGGAGATGCCCGTGGCCAAGTGCCG
AAGTCCAGATATAATGTCTCCACATACTACTCCGAGACCCAGAAACCGGGCAGCGTCAAGACCGAGTATGGATAC
TTCCTGGATGAAAGCATTGACATTGCTTCTGTGGATACATCCTTCTTCACAATGGGCAAGTTGGAGGTGGAGCGC
ATGGATCCACAGCAACGGCAGATGCTGGAAGTTGCCAGGGAGTGTATGGAAGATGCCGGCGAAACCAACTGGAAA
GGACGACCGATTGGGTGCTACATGGGTAGCTTTGGTGAAGACTGGCTTGAAATCTGTGTCAAAGAAACCCAACAA
TACGGCCAGCATCGAGTGAGCGGATATGGAGACTTCATGCTGCCTAACCGAGTCTCATATGAGATGGACCTGACG
GGGCCGAGGGGCGATTGCGAGAGCGCTATAGTTGGCGGTGCGAATTTGATAATGGCACCAGGCATGACAGCTGCC
ATGAGTGAGCAAGGCGTAATTTCACCGGATGGGTCTTGCAAGAGCTTCTCTGCCGATGCCAATGGTTATGCGCGA
GGAGAGGGAATCTCTGCTATCTTCATCAAGCCCCTGGCTGATGCCCTCCGGGATGGAAATCCAGTTCGAGCGGTT
ATCCGTTCGACATCATCCAACAGTGACGGAAGGGGTGCTGGAATCGGCGCACATGTTCCCAACGATGTTTCGCAC
GAGGCCATGATCAGGCGTGCATATGAGGTGGCAGGTATTACAGATTACTCCCAGACCGCATTTTTCGAGTGTCAT
GGTACTGGCACCCAAGTTGGAGATCCCATCGAAACCCGAGCAGTGGGTCGGGTTTTTGGTCCTTCTGGTGGTATC
CTCATTGGGTCTGTCAAACCCAATCTTGGTCACGCTGAAGGAGCTTCGGGAATTACATCCCTGATCAAGTCGGTA
CTAGCCCTGGAAAATCGGACCATTCCTCCAAATATCAAGTTTAAGGAGCGCAACCCCAACATCCAGTGGGATGAA
TATGGGCTCGCTGTTCCCACAGACCCGATGCCATGGCCTGAGGCCAGGAGCGAGCGAATTAGTGTGAACTCTTTT
GGAATTGGAGGTACCAACGCTCACGTTATTGTCGATTCAGCTCGGAGCTTTGGTGTCTCCCCCGTTGCCACACGG
CATACCATTTCGCCCCAGCTGCTTGTTTATTCCGCAAACAATGCCGAGTCACTAAAACAAATGATTTCCCACTAC
ACATCCTATGTTCAGAAGAACCCAGCCAGAGTTGCCGATCTGGCGTTCACTCTAGCTAATAAAAGGGAGCATCTG
CCTCATCGGGCATTCTCTGTGCAAAGCCCATTGGGTCCGCTCACGACTTCGGCACCCTCGAAAACTGGGGAGACA
CCAAATATCGTCATGGTTTTCACGGGCCAGGGCGCTCAGTGGCCACAAATGGGTGCCTCTATGATCCACAACGAC
GTCTATCCCGCATTTAAGAAGAGCATTCAAAATCTTGACTCACATTTGCAAACCCTCACAGATGCTCCAGACTGG
AGCATTGAAGAAGAGCTCTTGAAGGACCCCGATACCAGCAGACTCAGCTCGTCTGAATTATCCCAGCCTCTCTGT
ACAGCAATCCAGGTGGCTCTGATCGATACTTTTGCTTCCGTTGGAGTTCAACCTGCTGCTGTCGTGGGTCATTCC
AGCGGCGAAATAGCTGCTGCATACGCTGCCGGTGCTATCACAGCCACCGAAGCAATCACGATTGCATTCTATCGA
GGTCAGGTCACCAAGGCGCAAACCAGGCCTGGGTCCATGGCAGCTATAGGCATGGGAGCTGAGGACATCCAGGAA
TATCTACAGGACGGTGTCGTTGTTGCTTGCGAAAACTCACCTAAGAGTGTTACCCTCGCTGGTGATACACATGCT
ATTGAAAAGGTAGTTGCCATCATTAAGGAGGCCCATCCTGATGTCCTGGCTAGACAGTTGAAAGTCGACAAGGCG
TACCACTCTCATCATATGGCTGAGATAGGTGACGAGTACCATGCTTTGATTGAACATGAAATATCCACCAAGGCT
CCAAATAAGTTATTCTTCAGCAGTGTCGAGAACGAACTACTCACGGAAGCCCAACATCTCGGCCCTAAATACTGG
CAGATGAACCTTCAGTCTCCGGTCCTCTTCCGCTCGGCTGTATCGTCTATAATTAAGCACCAGATTTCGAAGAAT
ATGGTGCTGCTTGAAGTTGGACCGCACTCCGCTCTTGCGGGCCCCTTGCGACAGATCCAGAGTCATCTTTCCACT
TCTTCTCCTTATATTTCTACGTTTGTTCGCAACCAGGATAGTACGGAATCTTTCCTGACTGCCATTGGCCAACTG
CATGTTCTCAATGCTGTCCCAGCGTTGGATAAGGTCATCAGCACGGGCTCTACTCTCCCAGATCTTCCAAGATAC
CCATGGGATCACTCAAAGAAATTCTGGTATGAGTCTCGGTTGAGCAAGGAGTGGAGGCATCGCGAGCACAAATAT
CACGATCTTTTGGGTGTCCGGGTAACAGAGAGTCCTGACTTCCATCCTCTGTTCCGAAATCTCTTTCACTTGGAC
AACGCCCCGTGGATTCGCGACCACAAGGTTGGTGATGATATTGTATTCCCCTTCGCTGGCTATGCTGCGATGATT
GGCGAGGCTGTGAGACAGGTTACCGGAGTTCGCGAGGCATTCAAACTGCGCAACGTCATTGTCAGCACTGCCCTT
GTCTTGAATGAGGGCCCACCAGTTGAGATCATGACAACATTACATCGCCATAGATTGACTGATTCCCTGGACAGT
GAGTGGTGGGAATTTGCCATCACTTCTCACAACGGAGCGAATTGGATCAAGCATTGCTCAGGCGAGGTCAGATCG
CTTAACGAATACCTTGAAGATGTAGACAAGAAAGCCCCTCTTGTGCGCAAGGTTGAAACACGCCGTTGCTATCAT
TCTATGGCCATGTCTGGTCTGAATTTTGGGCCATCATTTCAACGTCTTGACCATGTCCGCTCAGACACTGTTTCG
CAGAGCGCGACGTCTGAACTTGTTGCGAAAGATACTGATGGGGATAACTATCATTTGCACCCCACAGTCATCGAT
GCCTCACTTCAGCTGCTCAGTGTCGCTGCTTCCAAAGGATATGCCGAACCGATAACCAACATAATGGTTCCTACT
CACATTCAAGAGATCTCCATCTACCGCTGTTATGAGAATGTCCACGTCCAAGCTTCCGCATCTTACACCCCGAAC
GGCTCTATCATTGGGAGTGGCCAGTGTATTACTGCAGGGGGGAAAGTTGCTTTACGCAGTTCTGGAATTAAACTC
TCTGTTCTCGATCATCAGGACCCTGAAAAGGGGGAACCCCCCATTGGCTGTGCAGAATGGGCTCCCCATATCGAC
TTCCTGGATGTCAACACTCTCATCAAGCCATTGATTGACCGCAGTGATTACATGCCCGCTTTGACAGAGCTATCT
CATCTGTGTATGATTTACACACAGCGTGTGATTGCGGATCTGGATACTCCAATCAGCCACATGTACAAGTATCGA
TCATGGATTGATCAACACCTGTTGTCTGTGGATCTGCAAAGTCTCCAAATCCTTGACAATATTGCCATTAAACAG
CGAGTGAAAGAACTCGTTGACCAAATTTCCCAAACTAATGGCGCCCATCTTGCTGTTGGTATTGAAGTGATTTTC
AATAACGTCCAACAGATTTTCACCGGGGAGGCTGAGGCTCTGGATCTCCTTCTGACCGATGACATATTGGCCAAC
GTCTACAACGCTATGGATCAGTGTGATATTTCCGAATTCATCAGGAACTTAACTCACACTAAGCCTAATCTGCGT
ATCCTCGAAATAGGTGCCGGAACCGGTGGGTCTACAGCTAATATCCTGAAGCTGTTGACCCCTGGGAGTAGGACC
CTATACATGAACTACACCTTCACGGATATCTCATCTGGCTTCTTTGTTGCTGCAAAGGATCGATTTGCCAGTTAC
CCAAACATCGAATACGCTACTCTCGACATTAGTAAGGATCCCTCCGATCAGGGGTTCGATGATCGCAAATACGAC
CTAATTCTGGCGACCAATGTCATCCACGCCACAGCATCCTTGAACGACAGTTTAAGCAACATTCATAAACTTCTT
TCTCCGACCGGATGGCTCCTGCTCCACGAATTGACACCCATATCCAAATGGATCAACTATATCTTTGGAACCCTG
GCCGGTTGGTGGTACGGCGAGGTTGATGGCCGGTCGGGCGAGCCGTACATAGGCATTGAACGCTGGGCAAAGGAA
CTCAAGGCCGCTGGATTTCGCACTCCTGATGCTGCAGTTCTGGATTCGAACCAACCACATCAGTTGAACGCCATG
ATCGTGGCGAGACCGGAGGTTGACATCGCACCTAAGAAATGCGTCACTGTCTTGACCCTCTCTAAATCAATGTCC
GTAGGTCCTTTGCTTCAGGCTCTGGATAACAGGGGATACTCCGTTCATCATTCTCGGTTTGACGAAGAGCCCCTG
CCTGAAGGACAAGATGTGATTGCCTTGCTTGATGAAGAAGCCCCATTCTTCGAAGGCATGGATAACCAACGCTTT
GACTCTTTCAAGAAATTGGCACACAGCCTAGATCAACGTGGTGTTCTGTGGGTGACTCGTTCATCACAAGCCCAA
TGTCGGGACCCGAGATTTGCCCAGATCAACGGCGTAGCGAGGACGATTCGCAATGAATTGCGTGTCGACTTTGCT
ACTTGCGAGGTTGACGATCTTGATGTCTCTTTTGAGAAACTCATCGACGTATATGAGAAGTTCCAAGTCCGCCAG
GAGGATGAGACCCTCAAGCCTGAATTTGAATACGCTATCGTGGACAATACGGTACAAGTTGGGCGGTATCATCCT
TTCTCGGCGCAAAATGGACAAGAGGCGCTGGCTTCAAATAGTAGCATCGCCCTTCGAACAAGTAAACCAGGCCGC
TTGGCTTCGTTACACTGGGCTCATGGGGATATCAAACCTCTGGAGGGAGATGAGGTGGAAATCGACACTTACGCA
ATCGGTTTGAATTTCAAGGATGTCTTATGTGCCATGGGTATTGTCGAAGCCAAAGAAAATGAATTTGGCCATGAA
GGCGCGGGCATAGTCCGCCGCACTGGCCCCGATGTTCAAAGTCTGAAAGTCGGTGATCGTGTCATGGTCGTCGGG
AGCTGTTTATTTGGGACGCAATTAGTTCTCTCCGAGAACCTGTGCGAGAAGATTCCAGGCGGCTTAAGCTTCAGT
GATGCGGCCAGCATGCCTTGCGTGTTCAGTACATCGATATACTCCATCTTTGACGTTGGAAATCTGAAAAAAGGA
CAGTCCATTCTTATCCATAGTGCCTGTGGTGGAGTTGGCATTGCGACCATTCAGCTTGCTCAAATGGTTGGTGCC
GAGATTTACGCAACTGTCGGTAACGAGGAGAAGGTCAGGTATCTCATGGACACGTTTGGCCTTCCTCGGAACAGG
ATCCTAAACTCCCGTAATGCCTCGTTTGTTGAGGATATCATGCGGGAGACAAATGGACAGGGTGTCGACTTGGCA
TTGAACTCATTGTCTGGTGAACTATTGCATGCTACGTGGAAATGCATTGCACCTTTTGGGAAGATGGTCGAGATT
GGCAAGCGAGACTTGATTGGCTCTGGAAAACTTGATATGACTCCTTTCTTGGACAACCGGAGCTATTGCTGTGTC
GACTTGGATCAAATTTGTTCCAGAAAGCCGATCCTTGCAAAGAAGCTGCTGAAGGAAATTGTGGACCTACTCAAG
GAGCGCTACATCTCTCCTATCCGACCTATCAAAGTCTTTAGTTCTGATGGAATACACGACGCTTTCCGTTACATG
CAGCAAGGCACTCATCTAGGAAAGATCGTTGTCTCGATGCGTGATACTTCAGGCCAGGTCAGCGCTGTACAAAAC
ATCCAGCCACGAAAAAAGCCCACCCAACTCAACAGCTCCGGTGCATACCTGCTCGTAGGTGGCCTCGGAGGCCTG
GGTCGGGCTATATCTACGTGGATGGTTCAACGTGGAGCTCGCCACCTCATATATCTTTCCCGAACTGCGGGTTCG
AGCGAAAGCCACCGCGAGTTTGCCCAAGAGCTTGCCAGTATGGATTGTCGTGTGGACTTTGTTCAAGGTAGCGTG
TCCAATATCGCGGATGTGACCACCGCTGTCACACGGGCTCAAGGCCGACTTCGGGGCATCTTGCAGATGTCCATG
ATGCTTCGTGATCGGAGCTTTGAACGCATGACACTAGAAGAGTGGAACACATCTGTTGATCCGAAGGTCAAGGGA
ACGTGGAACCTTCACAATGCTTCTGTATCTGCCAATGCGGAACTTGACTTCTTTGTTCTTTTCAGTTCGGTGTCT
GGTGTCTTTGGACTCCCTGGTCAGATCAACTATGCTGGTGCCAACACGTTCCTGGATGCATTTTCTCAATACCGA
TTGGGGTTGGGACTACCTGCTTGCGCGATCGATATCGGTATTGTCGAAGGAGTCGGTTATGCTGCCGAGCAGGAT
GAAATCTTACAAAAGCTCAAAGCCGCTGGTGGTCTAGGCAATACGGTCTCAGTGAGCGAGCTTCTGAGCGCGGTA
GAGGCAGCGATGACATCTATCTCAAGTAATTTGAGACCCCAAGCAGGCAACTTCGGCGTTGGAATTCGGCCCAAC
GTGCCTCTGGCCGATCAAAGAAACCGTTTGGTCTGGAAGAAGGACATACGAATGTCGGTGTTCCATAATACTGGA
GCAGCTGGTACCATCTTGACTTCTGCTTCTGACGCTGGTGCTGGCTTGGAGGCTTTTATTACACAGGCCAAGGGC
GACGCTGCGCTAATAAATCAACCTGGATCTGCTCAAATGCTCGCCGTGGAAATTGGAAAGAAGGTGTTTAGCTTC
TTGCTGAAGCCTGAAGAAGATCTGGTGACATCTTGCTCCTTGTCTGATCTTGGAATGGACTCTCTCGTGGCAATT
GAGGTGAAACAGTGGTGGAAGGCGACATTTGGGTTCGATATCAGTGTCCTGGAATTGATGGGAATGGGCTCTCTC
GATATACTCGGAGAGCACGCTGCTCATGGCATGCTTAGATTGTTCCATGGTGTACAAGATCAAGCTGATTGA
Transcript >Pro_DTO377G3_2|g744.t1
ATGATTCTCAAGGTTGTTGAACCGAAACCGGTTCCCCCAGAGCCAATCGCTATATGTGGAATGTCTGTACGTCTC
CCTGGAGGCCTACACACACCCCAACAGCTATGGGACTTCCTGGTTGCCAAAGGAGATGCCCGTGGCCAAGTGCCG
AAGTCCAGATATAATGTCTCCACATACTACTCCGAGACCCAGAAACCGGGCAGCGTCAAGACCGAGTATGGATAC
TTCCTGGATGAAAGCATTGACATTGCTTCTGTGGATACATCCTTCTTCACAATGGGCAAGTTGGAGGTGGAGCGC
ATGGATCCACAGCAACGGCAGATGCTGGAAGTTGCCAGGGAGTGTATGGAAGATGCCGGCGAAACCAACTGGAAA
GGACGACCGATTGGGTGCTACATGGGTAGCTTTGGTGAAGACTGGCTTGAAATCTGTGTCAAAGAAACCCAACAA
TACGGCCAGCATCGAGTGAGCGGATATGGAGACTTCATGCTGCCTAACCGAGTCTCATATGAGATGGACCTGACG
GGGCCGAGGGGCGATTGCGAGAGCGCTATAGTTGGCGGTGCGAATTTGATAATGGCACCAGGCATGACAGCTGCC
ATGAGTGAGCAAGGCGTAATTTCACCGGATGGGTCTTGCAAGAGCTTCTCTGCCGATGCCAATGGTTATGCGCGA
GGAGAGGGAATCTCTGCTATCTTCATCAAGCCCCTGGCTGATGCCCTCCGGGATGGAAATCCAGTTCGAGCGGTT
ATCCGTTCGACATCATCCAACAGTGACGGAAGGGGTGCTGGAATCGGCGCACATGTTCCCAACGATGTTTCGCAC
GAGGCCATGATCAGGCGTGCATATGAGGTGGCAGGTATTACAGATTACTCCCAGACCGCATTTTTCGAGTGTCAT
GGTACTGGCACCCAAGTTGGAGATCCCATCGAAACCCGAGCAGTGGGTCGGGTTTTTGGTCCTTCTGGTGGTATC
CTCATTGGGTCTGTCAAACCCAATCTTGGTCACGCTGAAGGAGCTTCGGGAATTACATCCCTGATCAAGTCGGTA
CTAGCCCTGGAAAATCGGACCATTCCTCCAAATATCAAGTTTAAGGAGCGCAACCCCAACATCCAGTGGGATGAA
TATGGGCTCGCTGTTCCCACAGACCCGATGCCATGGCCTGAGGCCAGGAGCGAGCGAATTAGTGTGAACTCTTTT
GGAATTGGAGGTACCAACGCTCACGTTATTGTCGATTCAGCTCGGAGCTTTGGTGTCTCCCCCGTTGCCACACGG
CATACCATTTCGCCCCAGCTGCTTGTTTATTCCGCAAACAATGCCGAGTCACTAAAACAAATGATTTCCCACTAC
ACATCCTATGTTCAGAAGAACCCAGCCAGAGTTGCCGATCTGGCGTTCACTCTAGCTAATAAAAGGGAGCATCTG
CCTCATCGGGCATTCTCTGTGCAAAGCCCATTGGGTCCGCTCACGACTTCGGCACCCTCGAAAACTGGGGAGACA
CCAAATATCGTCATGGTTTTCACGGGCCAGGGCGCTCAGTGGCCACAAATGGGTGCCTCTATGATCCACAACGAC
GTCTATCCCGCATTTAAGAAGAGCATTCAAAATCTTGACTCACATTTGCAAACCCTCACAGATGCTCCAGACTGG
AGCATTGAAGAAGAGCTCTTGAAGGACCCCGATACCAGCAGACTCAGCTCGTCTGAATTATCCCAGCCTCTCTGT
ACAGCAATCCAGGTGGCTCTGATCGATACTTTTGCTTCCGTTGGAGTTCAACCTGCTGCTGTCGTGGGTCATTCC
AGCGGCGAAATAGCTGCTGCATACGCTGCCGGTGCTATCACAGCCACCGAAGCAATCACGATTGCATTCTATCGA
GGTCAGGTCACCAAGGCGCAAACCAGGCCTGGGTCCATGGCAGCTATAGGCATGGGAGCTGAGGACATCCAGGAA
TATCTACAGGACGGTGTCGTTGTTGCTTGCGAAAACTCACCTAAGAGTGTTACCCTCGCTGGTGATACACATGCT
ATTGAAAAGGTAGTTGCCATCATTAAGGAGGCCCATCCTGATGTCCTGGCTAGACAGTTGAAAGTCGACAAGGCG
TACCACTCTCATCATATGGCTGAGATAGGTGACGAGTACCATGCTTTGATTGAACATGAAATATCCACCAAGGCT
CCAAATAAGTTATTCTTCAGCAGTGTCGAGAACGAACTACTCACGGAAGCCCAACATCTCGGCCCTAAATACTGG
CAGATGAACCTTCAGTCTCCGGTCCTCTTCCGCTCGGCTGTATCGTCTATAATTAAGCACCAGATTTCGAAGAAT
ATGGTGCTGCTTGAAGTTGGACCGCACTCCGCTCTTGCGGGCCCCTTGCGACAGATCCAGAGTCATCTTTCCACT
TCTTCTCCTTATATTTCTACGTTTGTTCGCAACCAGGATAGTACGGAATCTTTCCTGACTGCCATTGGCCAACTG
CATGTTCTCAATGCTGTCCCAGCGTTGGATAAGGTCATCAGCACGGGCTCTACTCTCCCAGATCTTCCAAGATAC
CCATGGGATCACTCAAAGAAATTCTGGTATGAGTCTCGGTTGAGCAAGGAGTGGAGGCATCGCGAGCACAAATAT
CACGATCTTTTGGGTGTCCGGGTAACAGAGAGTCCTGACTTCCATCCTCTGTTCCGAAATCTCTTTCACTTGGAC
AACGCCCCGTGGATTCGCGACCACAAGGTTGGTGATGATATTGTATTCCCCTTCGCTGGCTATGCTGCGATGATT
GGCGAGGCTGTGAGACAGGTTACCGGAGTTCGCGAGGCATTCAAACTGCGCAACGTCATTGTCAGCACTGCCCTT
GTCTTGAATGAGGGCCCACCAGTTGAGATCATGACAACATTACATCGCCATAGATTGACTGATTCCCTGGACAGT
GAGTGGTGGGAATTTGCCATCACTTCTCACAACGGAGCGAATTGGATCAAGCATTGCTCAGGCGAGGTCAGATCG
CTTAACGAATACCTTGAAGATGTAGACAAGAAAGCCCCTCTTGTGCGCAAGGTTGAAACACGCCGTTGCTATCAT
TCTATGGCCATGTCTGGTCTGAATTTTGGGCCATCATTTCAACGTCTTGACCATGTCCGCTCAGACACTGTTTCG
CAGAGCGCGACGTCTGAACTTGTTGCGAAAGATACTGATGGGGATAACTATCATTTGCACCCCACAGTCATCGAT
GCCTCACTTCAGCTGCTCAGTGTCGCTGCTTCCAAAGGATATGCCGAACCGATAACCAACATAATGGTTCCTACT
CACATTCAAGAGATCTCCATCTACCGCTGTTATGAGAATGTCCACGTCCAAGCTTCCGCATCTTACACCCCGAAC
GGCTCTATCATTGGGAGTGGCCAGTGTATTACTGCAGGGGGGAAAGTTGCTTTACGCAGTTCTGGAATTAAACTC
TCTGTTCTCGATCATCAGGACCCTGAAAAGGGGGAACCCCCCATTGGCTGTGCAGAATGGGCTCCCCATATCGAC
TTCCTGGATGTCAACACTCTCATCAAGCCATTGATTGACCGCAGTGATTACATGCCCGCTTTGACAGAGCTATCT
CATCTGTGTATGATTTACACACAGCGTGTGATTGCGGATCTGGATACTCCAATCAGCCACATGTACAAGTATCGA
TCATGGATTGATCAACACCTGTTGTCTGTGGATCTGCAAAGTCTCCAAATCCTTGACAATATTGCCATTAAACAG
CGAGTGAAAGAACTCGTTGACCAAATTTCCCAAACTAATGGCGCCCATCTTGCTGTTGGTATTGAAGTGATTTTC
AATAACGTCCAACAGATTTTCACCGGGGAGGCTGAGGCTCTGGATCTCCTTCTGACCGATGACATATTGGCCAAC
GTCTACAACGCTATGGATCAGTGTGATATTTCCGAATTCATCAGGAACTTAACTCACACTAAGCCTAATCTGCGT
ATCCTCGAAATAGGTGCCGGAACCGGTGGGTCTACAGCTAATATCCTGAAGCTGTTGACCCCTGGGAGTAGGACC
CTATACATGAACTACACCTTCACGGATATCTCATCTGGCTTCTTTGTTGCTGCAAAGGATCGATTTGCCAGTTAC
CCAAACATCGAATACGCTACTCTCGACATTAGTAAGGATCCCTCCGATCAGGGGTTCGATGATCGCAAATACGAC
CTAATTCTGGCGACCAATGTCATCCACGCCACAGCATCCTTGAACGACAGTTTAAGCAACATTCATAAACTTCTT
TCTCCGACCGGATGGCTCCTGCTCCACGAATTGACACCCATATCCAAATGGATCAACTATATCTTTGGAACCCTG
GCCGGTTGGTGGTACGGCGAGGTTGATGGCCGGTCGGGCGAGCCGTACATAGGCATTGAACGCTGGGCAAAGGAA
CTCAAGGCCGCTGGATTTCGCACTCCTGATGCTGCAGTTCTGGATTCGAACCAACCACATCAGTTGAACGCCATG
ATCGTGGCGAGACCGGAGGTTGACATCGCACCTAAGAAATGCGTCACTGTCTTGACCCTCTCTAAATCAATGTCC
GTAGGTCCTTTGCTTCAGGCTCTGGATAACAGGGGATACTCCGTTCATCATTCTCGGTTTGACGAAGAGCCCCTG
CCTGAAGGACAAGATGTGATTGCCTTGCTTGATGAAGAAGCCCCATTCTTCGAAGGCATGGATAACCAACGCTTT
GACTCTTTCAAGAAATTGGCACACAGCCTAGATCAACGTGGTGTTCTGTGGGTGACTCGTTCATCACAAGCCCAA
TGTCGGGACCCGAGATTTGCCCAGATCAACGGCGTAGCGAGGACGATTCGCAATGAATTGCGTGTCGACTTTGCT
ACTTGCGAGGTTGACGATCTTGATGTCTCTTTTGAGAAACTCATCGACGTATATGAGAAGTTCCAAGTCCGCCAG
GAGGATGAGACCCTCAAGCCTGAATTTGAATACGCTATCGTGGACAATACGGTACAAGTTGGGCGGTATCATCCT
TTCTCGGCGCAAAATGGACAAGAGGCGCTGGCTTCAAATAGTAGCATCGCCCTTCGAACAAGTAAACCAGGCCGC
TTGGCTTCGTTACACTGGGCTCATGGGGATATCAAACCTCTGGAGGGAGATGAGGTGGAAATCGACACTTACGCA
ATCGGTTTGAATTTCAAGGATGTCTTATGTGCCATGGGTATTGTCGAAGCCAAAGAAAATGAATTTGGCCATGAA
GGCGCGGGCATAGTCCGCCGCACTGGCCCCGATGTTCAAAGTCTGAAAGTCGGTGATCGTGTCATGGTCGTCGGG
AGCTGTTTATTTGGGACGCAATTAGTTCTCTCCGAGAACCTGTGCGAGAAGATTCCAGGCGGCTTAAGCTTCAGT
GATGCGGCCAGCATGCCTTGCGTGTTCAGTACATCGATATACTCCATCTTTGACGTTGGAAATCTGAAAAAAGGA
CAGTCCATTCTTATCCATAGTGCCTGTGGTGGAGTTGGCATTGCGACCATTCAGCTTGCTCAAATGGTTGGTGCC
GAGATTTACGCAACTGTCGGTAACGAGGAGAAGGTCAGGTATCTCATGGACACGTTTGGCCTTCCTCGGAACAGG
ATCCTAAACTCCCGTAATGCCTCGTTTGTTGAGGATATCATGCGGGAGACAAATGGACAGGGTGTCGACTTGGCA
TTGAACTCATTGTCTGGTGAACTATTGCATGCTACGTGGAAATGCATTGCACCTTTTGGGAAGATGGTCGAGATT
GGCAAGCGAGACTTGATTGGCTCTGGAAAACTTGATATGACTCCTTTCTTGGACAACCGGAGCTATTGCTGTGTC
GACTTGGATCAAATTTGTTCCAGAAAGCCGATCCTTGCAAAGAAGCTGCTGAAGGAAATTGTGGACCTACTCAAG
GAGCGCTACATCTCTCCTATCCGACCTATCAAAGTCTTTAGTTCTGATGGAATACACGACGCTTTCCGTTACATG
CAGCAAGGCACTCATCTAGGAAAGATCGTTGTCTCGATGCGTGATACTTCAGGCCAGGTCAGCGCTGTACAAAAC
ATCCAGCCACGAAAAAAGCCCACCCAACTCAACAGCTCCGGTGCATACCTGCTCGTAGGTGGCCTCGGAGGCCTG
GGTCGGGCTATATCTACGTGGATGGTTCAACGTGGAGCTCGCCACCTCATATATCTTTCCCGAACTGCGGGTTCG
AGCGAAAGCCACCGCGAGTTTGCCCAAGAGCTTGCCAGTATGGATTGTCGTGTGGACTTTGTTCAAGGTAGCGTG
TCCAATATCGCGGATGTGACCACCGCTGTCACACGGGCTCAAGGCCGACTTCGGGGCATCTTGCAGATGTCCATG
ATGCTTCGTGATCGGAGCTTTGAACGCATGACACTAGAAGAGTGGAACACATCTGTTGATCCGAAGGTCAAGGGA
ACGTGGAACCTTCACAATGCTTCTGTATCTGCCAATGCGGAACTTGACTTCTTTGTTCTTTTCAGTTCGGTGTCT
GGTGTCTTTGGACTCCCTGGTCAGATCAACTATGCTGGTGCCAACACGTTCCTGGATGCATTTTCTCAATACCGA
TTGGGGTTGGGACTACCTGCTTGCGCGATCGATATCGGTATTGTCGAAGGAGTCGGTTATGCTGCCGAGCAGGAT
GAAATCTTACAAAAGCTCAAAGCCGCTGGTGGTCTAGGCAATACGGTCTCAGTGAGCGAGCTTCTGAGCGCGGTA
GAGGCAGCGATGACATCTATCTCAAGTAATTTGAGACCCCAAGCAGGCAACTTCGGCGTTGGAATTCGGCCCAAC
GTGCCTCTGGCCGATCAAAGAAACCGTTTGGTCTGGAAGAAGGACATACGAATGTCGGTGTTCCATAATACTGGA
GCAGCTGGTACCATCTTGACTTCTGCTTCTGACGCTGGTGCTGGCTTGGAGGCTTTTATTACACAGGCCAAGGGC
GACGCTGCGCTAATAAATCAACCTGGATCTGCTCAAATGCTCGCCGTGGAAATTGGAAAGAAGGTGTTTAGCTTC
TTGCTGAAGCCTGAAGAAGATCTGGTGACATCTTGCTCCTTGTCTGATCTTGGAATGGACTCTCTCGTGGCAATT
GAGGTGAAACAGTGGTGGAAGGCGACATTTGGGTTCGATATCAGTGTCCTGGAATTGATGGGAATGGGCTCTCTC
GATATACTCGGAGAGCACGCTGCTCATGGCATGCTTAGATTGTTCCATGGTGTACAAGATCAAGCTGATTGA
Gene >Pro_DTO377G3_2|g744.t1
ATGATTCTCAAGGTTGTTGAACCGAAACCGGTTCCCCCAGAGCCAATCGCTATATGTGGAATGTCTGTACGTCTC
CCTGGAGGCCTACACACACCCCAACAGCTATGGGACTTCCTGGTTGCCAAAGGAGATGCCCGTGGCCAAGTGCCG
AAGTCCAGATATAATGTCTCCACATACTACTCCGAGACCCAGAAACCGGGCAGCGTCAAGACCGAGTATGGATAC
TTCCTGGATGAAAGCATTGACATTGCTTCTGTGGATACATCCTTCTTCACAATGGGCAAGTTGGAGGTGGAGCGC
ATGGATCCACAGCAACGGCAGATGCTGGAAGTTGCCAGGGAGTGTATGGAAGATGCCGGCGAAACCAACTGGAAA
GGACGACCGATTGGGTGCTACATGGGTAGCTTTGGTGAAGACTGGCTTGAAATCTGTGTCAAAGAAACCCAACAA
TACGGCCAGCATCGAGTGAGCGGATATGGAGACTTCATGCTGCCTAACCGAGTCTCATATGAGATGGACCTGACG
GGGCCGAGGTTAGTTGTTCCATATTTTTTTTTATCTTGGAATAGAATGCAATTGCTAAGTGGAAAAAAATAATAA
AGCATGGTCGTACGTACTGGCTGCTCAGCAGGTATTGTTGCACTGCATGAAGCATGTCTGGCAATTTCCAGGGGC
GATTGCGAGAGCGCTATAGTTGGCGGTGCGAATTTGATAATGGCACCAGGCATGACAGCTGCCATGAGTGAGCAA
GGCGTAATTTCACCGGATGGGTCTTGCAAGAGCTTCTCTGCCGATGCCAATGGTTATGCGCGAGGAGAGGGAATC
TCTGCTATCTTCATCAAGCCCCTGGCTGATGCCCTCCGGGATGGAAATCCAGTTCGAGCGGTTATCCGTTCGACA
TCATCCAACAGTGACGGAAGGGGTGCTGGAATCGGCGCACATGTTCCCAACGATGTTTCGCACGAGGCCATGATC
AGGCGTGCATATGAGGTGGCAGGTATTACAGATTACTCCCAGACCGCATTTTTCGAGTGTCATGGTACTGGCACC
CAAGTTGGAGATCCCATCGAAACCCGAGCAGTGGGTCGGGTTTTTGGTCCTTCTGGTGGTATCCTCATTGGGTCT
GTCAAACCCAATCTTGGTCACGCTGAAGGAGCTTCGGGAATTACATCCCTGATCAAGTCGGTACTAGCCCTGGAA
AATCGGACCATTCCTCCAAATATCAAGTTTAAGGAGCGCAACCCCAACATCCAGTGGGATGAATATGGGCTCGCT
GTTCCCACAGACCCGATGCCATGGCCTGAGGCCAGGAGCGAGCGAATTAGTGTGAACTCTTTTGGAATTGGAGGT
ACCAACGCTCACGTTATTGTCGATTCAGCTCGGAGCTTTGGTGTCTCCCCCGTTGCCACACGGCATACCATTTCG
CCCCAGCTGCTTGTTTATTCCGCAAACAATGCCGAGTCACTAAAACAAATGATTTCCCACTACACATCCTATGTT
CAGAAGAACCCAGCCAGAGTTGCCGATCTGGCGTTCACTCTAGCTAATAAAAGGGAGCATCTGCCTCATCGGGCA
TTCTCTGTGCAAAGCCCATTGGGTCCGCTCACGACTTCGGCACCCTCGAAAACTGGGGAGACACCAAATATCGTC
ATGGTTTTCACGGGCCAGGGCGCTCAGTGGCCACAAATGGGTGCCTCTATGATCCACAACGACGTCTATCCCGCA
TTTAAGAAGAGCATTCAAAATCTTGACTCACATTTGCAAACCCTCACAGATGCTCCAGACTGGAGCATTGAAGAA
GAGCTCTTGAAGGACCCCGATACCAGCAGACTCAGCTCGTCTGAATTATCCCAGCCTCTCTGTACAGCAATCCAG
GTGGCTCTGATCGATACTTTTGCTTCCGTTGGAGTTCAACCTGCTGCTGTCGTGGGTCATTCCAGCGGCGAAATA
GCTGCTGCATACGCTGCCGGTGCTATCACAGCCACCGAAGCAATCACGATTGCATTCTATCGAGGTCAGGTCACC
AAGGCGCAAACCAGGCCTGGGTCCATGGCAGCTATAGGCATGGGAGCTGAGGACATCCAGGAATATCTACAGGAC
GGTGTCGTTGTTGCTTGCGAAAACTCACCTAAGAGTGTTACCCTCGCTGGTGATACACATGCTATTGAAAAGGTA
GTTGCCATCATTAAGGAGGCCCATCCTGATGTCCTGGCTAGACAGTTGAAAGTCGACAAGGCGTACCACTCTCAT
CATATGGCTGAGATAGGTGACGAGTACCATGCTTTGATTGAACATGAAATATCCACCAAGGCTCCAAATAAGTTA
TTCTTCAGCAGTGTCGAGAACGAACTACTCACGGAAGCCCAACATCTCGGCCCTAAATACTGGCAGATGAACCTT
CAGTCTCCGGTCCTCTTCCGCTCGGCTGTATCGTCTATAATTAAGCACCAGATTTCGAAGAATATGGTGCTGCTT
GAAGTTGGACCGCACTCCGCTCTTGCGGGCCCCTTGCGACAGATCCAGAGTCATCTTTCCACTTCTTCTCCTTAT
ATTTCTACGTTTGTTCGCAACCAGGATAGTACGGAATCTTTCCTGACTGCCATTGGCCAACTGCATGTTCTCAAT
GCTGTCCCAGCGTTGGATAAGGTCATCAGCACGGGCTCTACTCTCCCAGATCTTCCAAGATACCCATGGGATCAC
TCAAAGAAATTCTGGTATGAGTCTCGGTTGAGCAAGGAGTGGAGGCATCGCGAGCACAAATATCACGATCTTTTG
GGTGTCCGGGTAACAGAGAGTCCTGACTTCCATCCTCTGTTCCGAAATCTCTTTCACTTGGACAACGCCCCGTGG
ATTCGCGACCACAAGGTTGGTGATGATATTGTATTCCCCTTCGCTGGCTATGCTGCGATGATTGGCGAGGCTGTG
AGACAGGTTACCGGAGTTCGCGAGGCATTCAAACTGCGCAACGTCATTGTCAGCACTGCCCTTGTCTTGAATGAG
GGCCCACCAGTTGAGATCATGACAACATTACATCGCCATAGATTGACTGATTCCCTGGACAGTGAGTGGTGGGAA
TTTGCCATCACTTCTCACAACGGAGCGAATTGGATCAAGCATTGCTCAGGCGAGGTCAGATCGCTTAACGAATAC
CTTGAAGATGTAGACAAGAAAGCCCCTCTTGTGCGCAAGGTTGAAACACGCCGTTGCTATCATTCTATGGCCATG
TCTGGTCTGAATTTTGGGCCATCATTTCAACGTCTTGACCATGTCCGCTCAGACACTGTTTCGCAGAGCGCGACG
TCTGAACTTGTTGCGAAAGATACTGATGGGGATAACTATCATTTGCACCCCACAGTCATCGATGCCTCACTTCAG
CTGCTCAGTGTCGCTGCTTCCAAAGGATATGCCGAACCGATAACCAACATAATGGTTCCTACTCACATTCAAGAG
ATCTCCATCTACCGCTGTTATGAGAATGTCCACGTCCAAGCTTCCGCATCTTACACCCCGAACGGCTCTATCATT
GGGAGTGGCCAGTGTATTACTGCAGGGGGGAAAGTTGCTTTACGCAGTTCTGGAATTAAACTCTCTGTTCTCGAT
CATCAGGACCCTGAAAAGGGGGAACCCCCCATTGGCTGTGCAGAATGGGCTCCCCATATCGACTTCCTGGATGTC
AACACTCTCATCAAGCCATTGATTGACCGCAGTGATTACATGCCCGCTTTGACAGAGCTATCTCATCTGTGTATG
ATTTACACACAGCGTGTGATTGCGGATCTGGATACTCCAATCAGCCACATGTACAAGTATCGATCATGGATTGAT
CAACACCTGTTGTCTGTGGATCTGCAAAGTCTCCAAATCCTTGACAATATTGCCATTAAACAGCGAGTGAAAGAA
CTCGTTGACCAAATTTCCCAAACTAATGGCGCCCATCTTGCTGTTGGTATTGAAGTGATTTTCAATAACGTCCAA
CAGATTTTCACCGGGGAGGCTGAGGCTCTGGATCTCCTTCTGACCGATGACATATTGGCCAACGTCTACAACGCT
ATGGATCAGTGTGATATTTCCGAATTCATCAGGAACTTAACTCACACTAAGCCTAATCTGCGTATCCTCGAAATA
GGTGCCGGAACCGGTGGGTCTACAGCTAATATCCTGAAGCTGTTGACCCCTGGGAGTAGGACCCTATACATGAAC
TACACCTTCACGGATATCTCATCTGGCTTCTTTGTTGCTGCAAAGGATCGATTTGCCAGTTACCCAAACATCGAA
TACGCTACTCTCGACATTAGTAAGGATCCCTCCGATCAGGGGTTCGATGATCGCAAATACGACCTAATTCTGGCG
ACCAATGTCATCCACGCCACAGCATCCTTGAACGACAGTTTAAGCAACATTCATAAACTTCTTTCTCCGACCGGA
TGGCTCCTGCTCCACGAATTGACACCCATATCCAAATGGATCAACTATATCTTTGGAACCCTGGCCGGTTGGTGG
TACGGCGAGGTTGATGGCCGGTCGGGCGAGCCGTACATAGGCATTGAACGCTGGGCAAAGGAACTCAAGGCCGCT
GGATTTCGCACTCCTGATGCTGCAGTTCTGGATTCGAACCAACCACATCAGTTGAACGCCATGATCGTGGCGAGA
CCGGAGGTTGACATCGCACCTAAGAAATGCGTCACTGTCTTGACCCTCTCTAAATCAATGTCCGTAGGTCCTTTG
CTTCAGGCTCTGGATAACAGGGGATACTCCGTTCATCATTCTCGGTTTGACGAAGAGCCCCTGCCTGAAGGACAA
GATGTGATTGCCTTGCTTGATGAAGAAGCCCCATTCTTCGAAGGCATGGATAACCAACGCTTTGACTCTTTCAAG
AAATTGGCACACAGCCTAGATCAACGTGGTGTTCTGTGGGTGACTCGTTCATCACAAGCCCAATGTCGGGACCCG
AGATTTGCCCAGATCAACGGCGTAGCGAGGACGATTCGCAATGAATTGCGTGTCGACTTTGCTACTTGCGAGGTT
GACGATCTTGATGTCTCTTTTGAGAAACTCATCGACGTATATGAGAAGTTCCAAGTCCGCCAGGAGGATGAGACC
CTCAAGCCTGAATTTGAATACGCTATCGTGGACAATACGGTACAAGTTGGGCGGTATCATCCTTTCTCGGCGCAA
AATGGACAAGAGGCGCTGGCTTCAAATAGTAGCATCGCCCTTCGAACAAGTAAACCAGGCCGCTTGGCTTCGTTA
CACTGGGCTCATGGGGATATCAAACCTCTGGAGGGAGATGAGGTGGAAATCGACACTTACGCAATCGGTTTGAAT
TTCAAGGTAAGTTCGAAGGTAACAAGTGGACCTAATAACACATACTGATATGAAACAGGATGTCTTATGTGCCAT
GGGTATTGTCGAAGCCAAAGAAAATGAATTTGGCCATGAAGGCGCGGGCATAGTCCGCCGCACTGGCCCCGATGT
TCAAAGTCTGAAAGTCGGTGATCGTGTCATGGTCGTCGGGAGCTGTTTATTTGGGACGCAATTAGTTCTCTCCGA
GAACCTGTGCGAGAAGATTCCAGGCGGCTTAAGCTTCAGTGATGCGGCCAGCATGCCTTGCGTGTTCAGTACATC
GATATACTCCATCTTTGACGTTGGAAATCTGAAAAAAGGACAGGTTTGTTCCCCCTCAACCTTTTGACGTTTTAG
GTCATCTTTTGACATATTTTATAGTCCATTCTTATCCATAGTGCCTGTGGTGGAGTTGGCATTGCGACCATTCAG
CTTGCTCAAATGGTTGGTGCCGAGATTTACGCAACTGTCGGTAACGAGGAGAAGGTCAGGTATCTCATGGACACG
TTTGGCCTTCCTCGGAACAGGATCCTAAACTCCCGTAATGCCTCGTTTGTTGAGGATATCATGCGGGAGACAAAT
GGACAGGGTGTCGACTTGGCATTGAACTCATTGTCTGGTGAACTATTGCATGCTACGTGGAAATGCATTGCACCT
TTTGGGAAGATGGTCGAGATTGGCAAGCGAGACTTGATTGGCTCTGGAAAACTTGATATGACTCCTTTCTTGGAC
AACCGGAGCTATTGCTGTGTCGACTTGGATCAAATTTGTTCCAGAAAGCCGATCCTTGCAAAGAAGTATGTATCG
AAGGGGATGACAATGTATGAGACTCGACAACTGACATATTATGCAGGCTGCTGAAGGAAATTGTGGACCTACTCA
AGGAGCGCTACATCTCTCCTATCCGACCTATCAAAGTCTTTAGTTCTGATGGAATACACGACGCTTTCCGTTACA
TGCAGCAAGGCACTCATCTAGGAAAGATCGTTGTCTCGATGCGTGATACTTCAGGCCAGGTCAGCGCTGTACAAA
ACATCCAGCCACGAAAAAAGCCCACCCAACTCAACAGCTCCGGTGCATACCTGCTCGTAGGTGGCCTCGGAGGCC
TGGGTCGGGCTATATCTACGTGGATGGTTCAACGTGGAGCTCGCCACCTCATATATCTTTCCCGAACTGCGGGTT
CGAGCGAAAGCCACCGCGAGTTTGCCCAAGAGCTTGCCAGTATGGATTGTCGTGTGGACTTTGTTCAAGGTAGCG
TGTCCAATATCGCGGATGTGACCACCGCTGTCACACGGGCTCAAGGCCGACTTCGGGGCATCTTGCAGATGTCCA
TGATGCTTCGTGATCGGAGCTTTGAACGCATGACACTAGAAGAGTGGAACACATCTGTTGATCCGAAGGTCAAGG
GAACGTGGAACCTTCACAATGCTTCTGTATCTGCCAATGCGGAACTTGACTTCTTTGTTCTTTTCAGTTCGGTGT
CTGGTGTCTTTGGACTCCCTGGTCAGATCAACTATGCTGGTGCCAACACGTTCCTGGATGCATTTTCTCAATACC
GATTGGGGTTGGGACTACCTGCTTGCGCGATCGATATCGGTATTGTCGAAGGAGTCGGTTATGCTGCCGAGCAGG
ATGAAATCTTACAAAAGCTCAAAGCCGCTGGTGGTCTAGGCAATACGGTCTCAGTGAGCGAGCTTCTGAGCGCGG
TAGAGGCAGCGATGACATCTATCTCAAGTAATTTGAGACCCCAAGCAGGCAACTTCGGCGTTGGAATTCGGCCCA
ACGTGCCTCTGGCCGATCAAAGAAACCGTTTGGTCTGGAAGAAGGACATACGAATGTCGGTGTTCCATAATACTG
GAGCAGCTGGTACCATCTTGACTTCTGCTTCTGACGCTGGTGCTGGCTTGGAGGCTTTTATTACACAGGCCAAGG
GCGACGCTGCGCTAATAAATCAACCTGGATCTGCTCAAATGCTCGCCGTGGAAATTGGAAAGAAGGTGTTTAGCT
TCTTGCTGAAGCCTGAAGAAGATCTGGTGACATCTTGCTCCTTGTCTGATCTTGGAATGGACTCTCTCGTGGCAA
TTGAGGTGAAACAGTGGTGGAAGGCGACATTTGGGTTCGATATCAGTGTCCTGGAATTGATGGGAATGGGCTCTC
TCGATATACTCGGAGAGCACGCTGCTCATGGCATGCTTAGATTGTTCCATGGTGTACAAGATCAAGCTGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail