Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7437.t1
Gene name
Locationscaffold_23:177795..179025
Strand+
Gene length (bp)1230
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.9E-19 70 139

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 216.32 132.59 300.05
5d_25C Five days - 25 degrees Celsius 248.34 151.01 345.66
7d_25C Seven days - 25 degrees Celsius 245.82 149.42 342.21
10d_25C Ten days - 25 degrees Celsius 343.11 204.56 481.66
7d_15C Seven days - 15 degrees Celsius 213.71 130.50 296.92
7d_30C Seven days - 30 degrees Celsius 251.83 152.38 351.28

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.603122 no
3d_25C 7d_25C 0.632376 no
3d_25C 7d_15C 0.972352 no
3d_25C 7d_30C 0.564782 no
3d_25C 10d_25C 0.027506 yes
5d_25C 7d_25C 0.976358 no
5d_25C 7d_15C 0.566477 no
5d_25C 7d_30C 0.967595 no
5d_25C 10d_25C 0.148643 no
7d_25C 7d_15C 0.599786 no
7d_25C 7d_30C 0.943344 no
7d_25C 10d_25C 0.130858 no
7d_15C 7d_30C 0.529627 no
7d_15C 10d_25C 0.024892 yes
7d_30C 10d_25C 0.173659 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7437.t1
MADYDNDSSRYADEPRYDRERSASPRDEPRADRDRARSRSPNGRSDDRAPLARKPVEEDDEGAINSGSNLFVTGI
HPRLTESDISRLFEKYGDVDNCSIMLDPHTKESRGFGFVNMVTAEQADAAKEGLQGEVIEGRTLSIEKARRARPR
TPTPGKYFGPPKRDGPGGPPGGPGGGSRGGGPRRDRYDDRRGPSGGGWRRRDDDYSRYGRYDSYNDRRDYGRDYG
RDYGRRDYAGGGGGGGREYGGRRESRDDYAYRGGGDRYGGGRDDRYSRDERRGGAEASRGSGGGGAGYYDRDANP
PSFDAAAPPREARDPYAGGGGRSYEGQARSSTGGAPGGGGGSGGGAGEDRYAGR*
Coding >Pro_DTO377G3_2|g7437.t1
ATGGCGGACTACGACAACGATTCCAGCCGCTACGCGGACGAGCCCCGATATGATCGCGAGCGCAGCGCCTCTCCT
CGCGATGAGCCTCGAGCCGACCGCGACCGTGCTCGCAGCCGCTCCCCCAATGGCCGTTCTGATGACAGAGCTCCT
CTGGCCCGCAAACCTGTCGAGGAAGACGATGAAGGTGCCATCAACTCTGGCTCTAACCTCTTTGTTACTGGTATT
CACCCGCGTCTGACCGAGTCTGATATTTCGCGTCTGTTTGAGAAGTACGGTGATGTCGATAACTGTTCTATCATG
CTTGATCCCCACACCAAGGAGTCGCGTGGATTCGGTTTCGTGAACATGGTCACCGCCGAGCAGGCTGATGCCGCC
AAGGAGGGTCTCCAGGGCGAAGTTATTGAAGGTCGTACCCTGAGCATCGAGAAGGCTCGACGTGCACGCCCTCGT
ACCCCTACCCCTGGAAAGTACTTTGGTCCTCCCAAACGTGATGGCCCAGGTGGTCCCCCAGGTGGTCCTGGTGGT
GGTAGCCGTGGAGGTGGTCCTCGCCGTGACCGCTACGATGATCGCCGTGGACCCTCCGGTGGCGGCTGGCGTCGT
CGCGATGATGACTACTCCCGCTACGGTCGCTACGACTCTTACAATGATCGCCGTGACTATGGCCGTGACTACGGA
CGTGACTATGGCCGCCGTGACTACGCTGGTGGTGGCGGTGGTGGTGGCCGTGAGTATGGTGGTCGCCGTGAATCA
CGCGACGACTACGCATACCGTGGTGGCGGTGACCGCTACGGCGGTGGCCGTGATGACCGTTACAGCCGCGATGAA
CGTCGCGGAGGTGCTGAGGCATCTCGCGGCAGCGGTGGCGGCGGCGCTGGCTACTACGATCGTGACGCCAACCCT
CCTAGCTTCGATGCTGCTGCCCCTCCCCGTGAGGCTCGCGACCCCTACGCTGGTGGTGGTGGACGTTCCTACGAA
GGTCAGGCACGCAGCAGCACTGGTGGTGCTCCTGGCGGTGGCGGTGGCAGCGGCGGCGGTGCCGGCGAGGACCGG
TACGCTGGCAGGTAA
Transcript >Pro_DTO377G3_2|g7437.t1
ATGGCGGACTACGACAACGATTCCAGCCGCTACGCGGACGAGCCCCGATATGATCGCGAGCGCAGCGCCTCTCCT
CGCGATGAGCCTCGAGCCGACCGCGACCGTGCTCGCAGCCGCTCCCCCAATGGCCGTTCTGATGACAGAGCTCCT
CTGGCCCGCAAACCTGTCGAGGAAGACGATGAAGGTGCCATCAACTCTGGCTCTAACCTCTTTGTTACTGGTATT
CACCCGCGTCTGACCGAGTCTGATATTTCGCGTCTGTTTGAGAAGTACGGTGATGTCGATAACTGTTCTATCATG
CTTGATCCCCACACCAAGGAGTCGCGTGGATTCGGTTTCGTGAACATGGTCACCGCCGAGCAGGCTGATGCCGCC
AAGGAGGGTCTCCAGGGCGAAGTTATTGAAGGTCGTACCCTGAGCATCGAGAAGGCTCGACGTGCACGCCCTCGT
ACCCCTACCCCTGGAAAGTACTTTGGTCCTCCCAAACGTGATGGCCCAGGTGGTCCCCCAGGTGGTCCTGGTGGT
GGTAGCCGTGGAGGTGGTCCTCGCCGTGACCGCTACGATGATCGCCGTGGACCCTCCGGTGGCGGCTGGCGTCGT
CGCGATGATGACTACTCCCGCTACGGTCGCTACGACTCTTACAATGATCGCCGTGACTATGGCCGTGACTACGGA
CGTGACTATGGCCGCCGTGACTACGCTGGTGGTGGCGGTGGTGGTGGCCGTGAGTATGGTGGTCGCCGTGAATCA
CGCGACGACTACGCATACCGTGGTGGCGGTGACCGCTACGGCGGTGGCCGTGATGACCGTTACAGCCGCGATGAA
CGTCGCGGAGGTGCTGAGGCATCTCGCGGCAGCGGTGGCGGCGGCGCTGGCTACTACGATCGTGACGCCAACCCT
CCTAGCTTCGATGCTGCTGCCCCTCCCCGTGAGGCTCGCGACCCCTACGCTGGTGGTGGTGGACGTTCCTACGAA
GGTCAGGCACGCAGCAGCACTGGTGGTGCTCCTGGCGGTGGCGGTGGCAGCGGCGGCGGTGCCGGCGAGGACCGG
TACGCTGGCAGGTAA
Gene >Pro_DTO377G3_2|g7437.t1
ATGGCGGACTACGACAACGATTCCAGCCGCTACGCGGGTATGTCTTTTAGAATTGTTTCCATGCGCTTGAAAATA
TTTACCCTTTTTCAATAGACGAGCCCCGATATGATCGCGAGCGCAGCGCCTCTCCTCGCGATGAGCCTCGAGCCG
ACCGCGACCGTGCTCGCAGCCGCTCCCCCAATGGCCGTTCTGATGACAGGTATGTATTTGTCTAGTCCGGTATAT
CAATTAGAAGCTAATAAACCCCAGAGCTCCTCTGGCCCGCAAACCTGTCGAGGAAGACGATGAAGGTGCCATCAA
CTCTGGCTCTAACCTCTTTGTTACTGGTATTCACCCGCGTCTGACCGAGTCTGATATTTCGCGTCTGTTTGAGAA
GTACGGTGATGTCGATAACTGTTCTATCATGCTTGATCCCCACACCAAGGAGTCGCGTGGATTCGGTTTCGTGAA
CATGGTCACCGCCGAGCAGGCTGATGCCGCCAAGGAGGGTCTCCAGGGCGAAGTTATTGAAGGTCGTACCCTGAG
CATCGAGAAGGCTCGACGTGCACGCCCTCGTACCCCTACCCCTGGAAAGTACTTTGGTCCTCCCAAACGTGGTAA
GTCACATCGTCCTGTCCCCTTGCGCCTTACGTCGACTTACATTTTTCCTCTTTAGATGGCCCAGGTGGTCCCCCA
GGTGGTCCTGGTGGTGGTAGCCGTGGAGGTGGTCCTCGCCGTGACCGCTACGATGATCGCCGTGGACCCTCCGGT
GGCGGCTGGCGTCGTCGCGATGATGACTACTCCCGCTACGGTCGCTACGACTCTTACAATGATCGCCGTGACTAT
GGCCGTGACTACGGACGTGACTATGGCCGCCGTGACTACGCTGGTGGTGGCGGTGGTGGTGGCCGTGAGTATGGT
GGTCGCCGTGAATCACGCGACGACTACGCATACCGTGGTGGCGGTGACCGCTACGGCGGTGGCCGTGATGACCGT
TACAGCCGCGATGAACGTCGCGGAGGTGCTGAGGCATCTCGCGGCAGCGGTGGCGGCGGCGCTGGCTACTACGAT
CGTGACGCCAACCCTCCTAGCTTCGATGCTGCTGCCCCTCCCCGTGAGGCTCGCGACCCCTACGCTGGTGGTGGT
GGACGTTCCTACGAAGGTCAGGCACGCAGCAGCACTGGTGGTGCTCCTGGCGGTGGCGGTGGCAGCGGCGGCGGT
GCCGGCGAGGACCGGTACGCTGGCAGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail