Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g741.t1
Gene name
Locationscaffold_01:1898999..1900643
Strand-
Gene length (bp)1644
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00441 Acyl-CoA_dh_1 Acyl-CoA dehydrogenase, C-terminal domain 1.5E-29 348 503
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 2.4E-20 7 78
PF02770 Acyl-CoA_dh_M Acyl-CoA dehydrogenase, middle domain 5.3E-19 245 334
PF02771 Acyl-CoA_dh_N Acyl-CoA dehydrogenase, N-terminal domain 4.1E-09 115 206

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0016491 oxidoreductase activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 59.35 36.06 82.63
5d_25C Five days - 25 degrees Celsius 56.85 34.45 79.26
7d_25C Seven days - 25 degrees Celsius 55.63 33.68 77.59
10d_25C Ten days - 25 degrees Celsius 62.50 37.78 87.22
7d_15C Seven days - 15 degrees Celsius 75.55 46.23 104.87
7d_30C Seven days - 30 degrees Celsius 43.06 25.51 60.61

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.897025 no
3d_25C 7d_25C 0.834396 no
3d_25C 7d_15C 0.300043 no
3d_25C 7d_30C 0.158622 no
3d_25C 10d_25C 0.871704 no
5d_25C 7d_25C 0.950144 no
5d_25C 7d_15C 0.206957 no
5d_25C 7d_30C 0.236356 no
5d_25C 10d_25C 0.745252 no
7d_25C 7d_15C 0.168419 no
7d_25C 7d_30C 0.285653 no
7d_25C 10d_25C 0.677799 no
7d_15C 7d_30C 0.007779 yes
7d_15C 10d_25C 0.446827 no
7d_30C 10d_25C 0.096455 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g741.t1
MSSETLTRAEVAKHNTEDSLWCIIDHQVYDLTDFVDAHPGGAVVLAQIAGQDATSDFYNLHRQEVLEKYRDQLCI
GVIEGEKPEVIVPVPGGLSPVPYAEPLWLRPQFKSPYYKESHRRLQKAVREFTDKYVTPEAQEKERDGTYISQEL
INRMAETNLLAMRLGPGKHLHGRTLLGGVVDGKEFDYLHDMIVTQELVRANARGFQDGNMAGMAISLTAVQQWLH
DPVLKERINGEVLSGQKKMCLAVTEAFAGSDVAGLKTTAEKTPDGKHYIVNGTKKWITNGMFADYFVTACRTEKG
FSVLLIPRGEGVETKQIKTSYSTAAGTAFVQYENVKVPVQNLLGEEHKGFLVIMSNFNHERFMMVAAVVRMSMVV
VEETMKWSNQRIVFGKKLIEQPVIRQKLARMISLAESNQAWLESIAYQMCNMTYAEQAKNLGGPIGLLKSHCTQA
AGEIASLATNIFGGRGITQSGMGKVIEMFHRTYKFDAILGGTEEILADLGVRQAMKNFPKSML*
Coding >Pro_DTO377G3_2|g741.t1
ATGTCATCAGAAACCCTGACGCGCGCGGAAGTCGCGAAGCACAACACCGAGGATTCCCTCTGGTGTATCATCGAC
CACCAAGTCTATGATCTAACCGATTTTGTCGACGCCCATCCCGGTGGTGCTGTTGTACTTGCTCAGATTGCTGGC
CAGGACGCAACATCCGATTTCTACAATCTGCACCGCCAGGAGGTGCTGGAGAAATACCGTGACCAGCTTTGCATT
GGTGTCATCGAAGGCGAAAAGCCCGAGGTCATCGTGCCCGTCCCTGGAGGTTTGAGCCCCGTGCCCTACGCAGAA
CCCCTGTGGCTGCGACCCCAGTTCAAGTCCCCATACTACAAGGAAAGCCACCGACGCTTGCAAAAGGCCGTCCGG
GAGTTCACAGATAAATATGTAACGCCAGAAGCGCAAGAGAAGGAGCGGGATGGCACCTACATCAGCCAGGAGCTC
ATCAATCGCATGGCCGAGACGAACCTTCTGGCTATGCGACTGGGCCCTGGAAAGCATCTGCATGGCCGCACCTTG
CTCGGTGGAGTTGTGGATGGAAAGGAGTTTGATTATCTCCACGATATGATTGTAACACAGGAGTTGGTCCGTGCC
AATGCGAGAGGCTTCCAGGATGGAAATATGGCAGGCATGGCTATTAGTTTGACAGCTGTCCAGCAATGGCTGCAC
GATCCTGTACTCAAGGAGCGCATCAATGGCGAGGTCTTGTCCGGCCAGAAAAAGATGTGTTTGGCTGTCACGGAG
GCCTTTGCTGGTAGCGACGTGGCGGGTCTGAAGACGACTGCAGAGAAGACTCCTGATGGGAAACATTATATTGTC
AACGGAACAAAGAAATGGATTACAAACGGTATGTTCGCCGACTACTTTGTCACTGCCTGCCGTACCGAGAAGGGA
TTCTCCGTGCTCTTGATTCCTCGCGGCGAAGGTGTGGAGACAAAGCAAATCAAGACCTCATATTCGACTGCCGCT
GGTACTGCTTTCGTGCAATATGAGAATGTCAAGGTTCCGGTTCAGAACCTCCTGGGTGAGGAGCACAAAGGTTTC
CTCGTTATCATGAGCAACTTCAACCACGAGCGCTTTATGATGGTAGCTGCCGTGGTCCGCATGTCAATGGTGGTT
GTCGAAGAAACAATGAAATGGTCCAATCAACGCATCGTCTTTGGTAAGAAGTTGATTGAACAGCCAGTTATTCGT
CAGAAGCTCGCCCGCATGATCTCCCTAGCCGAATCTAACCAGGCATGGCTTGAATCCATCGCCTATCAAATGTGC
AACATGACATACGCCGAACAAGCAAAGAATCTGGGTGGACCTATCGGACTGCTCAAATCACACTGTACCCAAGCC
GCAGGCGAAATTGCCAGTCTCGCTACAAACATCTTTGGTGGTCGTGGTATCACTCAGTCAGGAATGGGCAAGGTC
ATTGAGATGTTCCATCGCACATACAAGTTTGATGCCATCTTGGGTGGAACTGAGGAGATTTTGGCGGATTTGGGA
GTGCGGCAGGCAATGAAGAATTTCCCGAAGTCGATGTTATAG
Transcript >Pro_DTO377G3_2|g741.t1
ATGTCATCAGAAACCCTGACGCGCGCGGAAGTCGCGAAGCACAACACCGAGGATTCCCTCTGGTGTATCATCGAC
CACCAAGTCTATGATCTAACCGATTTTGTCGACGCCCATCCCGGTGGTGCTGTTGTACTTGCTCAGATTGCTGGC
CAGGACGCAACATCCGATTTCTACAATCTGCACCGCCAGGAGGTGCTGGAGAAATACCGTGACCAGCTTTGCATT
GGTGTCATCGAAGGCGAAAAGCCCGAGGTCATCGTGCCCGTCCCTGGAGGTTTGAGCCCCGTGCCCTACGCAGAA
CCCCTGTGGCTGCGACCCCAGTTCAAGTCCCCATACTACAAGGAAAGCCACCGACGCTTGCAAAAGGCCGTCCGG
GAGTTCACAGATAAATATGTAACGCCAGAAGCGCAAGAGAAGGAGCGGGATGGCACCTACATCAGCCAGGAGCTC
ATCAATCGCATGGCCGAGACGAACCTTCTGGCTATGCGACTGGGCCCTGGAAAGCATCTGCATGGCCGCACCTTG
CTCGGTGGAGTTGTGGATGGAAAGGAGTTTGATTATCTCCACGATATGATTGTAACACAGGAGTTGGTCCGTGCC
AATGCGAGAGGCTTCCAGGATGGAAATATGGCAGGCATGGCTATTAGTTTGACAGCTGTCCAGCAATGGCTGCAC
GATCCTGTACTCAAGGAGCGCATCAATGGCGAGGTCTTGTCCGGCCAGAAAAAGATGTGTTTGGCTGTCACGGAG
GCCTTTGCTGGTAGCGACGTGGCGGGTCTGAAGACGACTGCAGAGAAGACTCCTGATGGGAAACATTATATTGTC
AACGGAACAAAGAAATGGATTACAAACGGTATGTTCGCCGACTACTTTGTCACTGCCTGCCGTACCGAGAAGGGA
TTCTCCGTGCTCTTGATTCCTCGCGGCGAAGGTGTGGAGACAAAGCAAATCAAGACCTCATATTCGACTGCCGCT
GGTACTGCTTTCGTGCAATATGAGAATGTCAAGGTTCCGGTTCAGAACCTCCTGGGTGAGGAGCACAAAGGTTTC
CTCGTTATCATGAGCAACTTCAACCACGAGCGCTTTATGATGGTAGCTGCCGTGGTCCGCATGTCAATGGTGGTT
GTCGAAGAAACAATGAAATGGTCCAATCAACGCATCGTCTTTGGTAAGAAGTTGATTGAACAGCCAGTTATTCGT
CAGAAGCTCGCCCGCATGATCTCCCTAGCCGAATCTAACCAGGCATGGCTTGAATCCATCGCCTATCAAATGTGC
AACATGACATACGCCGAACAAGCAAAGAATCTGGGTGGACCTATCGGACTGCTCAAATCACACTGTACCCAAGCC
GCAGGCGAAATTGCCAGTCTCGCTACAAACATCTTTGGTGGTCGTGGTATCACTCAGTCAGGAATGGGCAAGGTC
ATTGAGATGTTCCATCGCACATACAAGTTTGATGCCATCTTGGGTGGAACTGAGGAGATTTTGGCGGATTTGGGA
GTGCGGCAGGCAATGAAGAATTTCCCGAAGTCGATGTTATAG
Gene >Pro_DTO377G3_2|g741.t1
ATGTCATCAGAAACCCTGACGCGCGCGGAAGTCGCGAAGCACAACACCGAGGATTCCCTCTGGTGTATCATCGAC
CACCAAGTCTATGATCTAACCGATTTTGTCGACGCCCATCCCGGTGGTGCTGTTGTACTTGCTCAGATTGCTGGC
CAGGACGCAACATCCGATTTCTACAATCTGCACCGCCAGGAGGTGCTGGAGAAATACCGTGACCAGCTTTGCATT
GGTGTCATCGAAGGCGAAAAGCCCGAGGTCATCGTGCCCGTCCCTGGAGGTTTGAGCCCCGTGCCCTACGCAGAA
CCCCTGTGGCTGCGACCCCAGTTCAAGTCCCCATACTACAAGGAAAGCCACCGACGCTTGCAAAAGGCCGTCCGG
GAGTTCACAGATAAATATGTAACGCCAGAAGCGCAAGAGAAGGAGCGGGATGGCACCTACATCAGCCAGGAGCTC
ATCAATCGCATGGCCGAGACGAACCTTCTGGCTATGCGACTGGGCCCTGGAAAGCATCTGCATGGCCGCACCTTG
CTCGGTGGAGTTGTGGATGGAAAGGAGTTTGATTATCTCCACGATATGATTGTAACACAGGAGTTGGTCCGTGCC
AATGCGAGAGGCTTCCAGGATGGAAATATGGCAGGCATGGCTATTAGTTTGACAGCTGTCCAGCAATGGCTGCAC
GATCCTGTACTCAAGGAGCGCATCAATGGCGAGGTCTTGTCCGGCCAGAAAAAGATGTGTTTGGCTGTCACGGAG
GCCTTTGCTGGTAGCGACGTGGCGGGTCTGAAGACGACTGCAGAGAAGACTCCTGATGGGAAACATTATATTGTC
AACGGAACAAAGTCAGTCGGATCACGTTTGTTGTTTAATTGGATTTGCGCTGACAATGTCTAGGAAATGGATTAC
AAACGGTATGTTCGCCGACTACTTTGTCACTGCCTGCCGTACCGAGAAGGGATTCTCCGTGCTCTTGATTCCTCG
CGGCGAAGGTGTGGAGACAAAGCAAATCAAGACCTCATATTCGACTGCCGCTGGTACTGCTTTCGTGCAATATGA
GAATGTCAAGGTTCCGGTTCAGAACCTCCTGGGTGAGGAGCACAAAGGTTTCCTCGTTATCATGAGCAACTTCAA
CCACGAGCGCTTTATGATGGTAGCTGCCGTGGTCCGCATGTCAATGGTGGTTGTCGAAGAAACAATGAAATGGTC
CAATCAACGCATCGTCTTTGGTAAGAAGTTGATTGAACAGCCAGTTATTCGTCAGAAGTGAGTTTCTTACAATCT
GCTCTTAATATCCCTCTTCTAACTCCCGACAGGCTCGCCCGCATGATCTCCCTAGCCGAATCTAACCAGGCATGG
CTTGAATCCATCGCCTATCAAATGTGCAACATGACATACGCCGAACAAGCAAAGAATCTGGGTGGACCTATCGGA
CTGCTCAAATCACACTGTACCCAAGCCGCAGGCGAAATTGCCAGTCTCGCTACAAACATCTTTGGTGGTCGTGGT
ATCACTCAGTCAGGAATGGGCAAGGTCATTGAGATGTTCCATCGCACATACAAGTTTGATGCCATCTTGGGTGGA
ACTGAGGAGATTTTGGCGGATTTGGGAGTGCGGCAGGCAATGAAGAATTTCCCGAAGTCGATGTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail