Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7402.t1
Gene name
Locationscaffold_23:73576..74762
Strand-
Gene length (bp)1186
Transcript length (bp)1053
Coding sequence length (bp)1053
Protein length (aa) 351

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01012 ETF Electron transfer flavoprotein domain 8.0E-44 37 202
PF00766 ETF_alpha Electron transfer flavoprotein FAD-binding domain 4.0E-32 227 308

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 194.17 118.33 270.00
5d_25C Five days - 25 degrees Celsius 108.40 65.95 150.85
7d_25C Seven days - 25 degrees Celsius 90.74 54.87 126.61
10d_25C Ten days - 25 degrees Celsius 68.65 40.58 96.72
7d_15C Seven days - 15 degrees Celsius 101.61 60.87 142.34
7d_30C Seven days - 30 degrees Celsius 92.22 55.81 128.62

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.002297 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.001278 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.489852 no
5d_25C 7d_15C 0.840192 no
5d_25C 7d_30C 0.539472 no
5d_25C 10d_25C 0.031095 yes
7d_25C 7d_15C 0.694339 no
7d_25C 7d_30C 0.962746 no
7d_25C 10d_25C 0.235453 no
7d_15C 7d_30C 0.740816 no
7d_15C 10d_25C 0.081384 no
7d_30C 10d_25C 0.208650 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7402.t1
MIPIARHSVLRAARAQLQPTRKLSLPTSSALARLLSTLAVLEQRNGKLESSSFSAVAAALKLGGSVTGFVAGSGV
KATSAAEAAKIKGVEKVLAVDNDAYEKGLAENYASLLVENIKKGEFTHVIAGHSAFGKSVLPRVAALLDVQQISD
ITGIESEDTFVRPIYAGNAILTVQSTDKIKVITVRGTAFQDVEVEGGSAEVVDGVDPNVPALTEWVSEELAKSER
PELATATRVVSGGRGLKSKEEFDRLMLPLADSLGAAVGASRAAVDSGFADNSLQVGQTGKNVAPQLYLCAGISGA
IQHLAGMKDSKVIAAINKDPEAPIFQVADVGLVGDLFDKVPELTEKLKSA*
Coding >Pro_DTO377G3_2|g7402.t1
ATGATTCCAATCGCTAGGCACTCTGTCCTGCGGGCTGCCCGCGCTCAGCTCCAACCCACCCGGAAGCTTAGCCTG
CCCACTTCTTCGGCGCTTGCCCGCCTCCTCTCGACCCTCGCCGTCCTCGAGCAGCGCAATGGAAAGCTGGAATCT
TCGTCTTTTTCCGCAGTCGCGGCTGCACTGAAGCTCGGTGGCTCAGTAACGGGCTTCGTTGCTGGCTCTGGTGTG
AAGGCCACCTCCGCTGCCGAGGCTGCTAAGATCAAGGGTGTTGAGAAGGTGCTGGCCGTGGACAACGACGCATAC
GAGAAGGGCCTCGCCGAGAACTATGCCTCTCTTCTTGTCGAGAACATCAAGAAGGGCGAATTCACCCACGTCATT
GCAGGCCACTCTGCCTTTGGAAAGAGCGTGTTGCCCCGCGTGGCTGCCCTCTTGGATGTGCAGCAAATCTCGGAC
ATCACCGGTATCGAGAGCGAGGACACTTTCGTCCGCCCCATCTACGCCGGTAACGCGATTCTGACCGTCCAGTCA
ACCGACAAGATCAAGGTGATCACAGTGCGAGGCACCGCCTTCCAGGACGTCGAGGTTGAGGGCGGCTCCGCCGAG
GTCGTCGACGGAGTGGACCCCAACGTTCCCGCGCTCACCGAGTGGGTGTCCGAGGAATTGGCCAAGTCAGAACGC
CCGGAGCTCGCCACAGCCACACGTGTTGTGTCTGGAGGCCGTGGCTTGAAGTCCAAGGAGGAGTTTGACCGCCTC
ATGCTTCCGCTGGCGGATTCCCTCGGCGCTGCTGTTGGTGCTTCGCGTGCTGCTGTTGACAGTGGCTTCGCCGAT
AACAGTCTGCAGGTTGGCCAGACTGGTAAGAACGTTGCTCCTCAGCTCTACCTCTGTGCCGGTATCTCCGGTGCT
ATCCAGCACTTGGCTGGTATGAAGGACAGCAAGGTCATTGCTGCTATCAACAAAGATCCCGAGGCTCCTATCTTC
CAGGTTGCTGATGTTGGCCTCGTCGGTGACTTGTTTGACAAGGTACCCGAGCTGACCGAGAAGCTCAAGAGCGCC
TAA
Transcript >Pro_DTO377G3_2|g7402.t1
ATGATTCCAATCGCTAGGCACTCTGTCCTGCGGGCTGCCCGCGCTCAGCTCCAACCCACCCGGAAGCTTAGCCTG
CCCACTTCTTCGGCGCTTGCCCGCCTCCTCTCGACCCTCGCCGTCCTCGAGCAGCGCAATGGAAAGCTGGAATCT
TCGTCTTTTTCCGCAGTCGCGGCTGCACTGAAGCTCGGTGGCTCAGTAACGGGCTTCGTTGCTGGCTCTGGTGTG
AAGGCCACCTCCGCTGCCGAGGCTGCTAAGATCAAGGGTGTTGAGAAGGTGCTGGCCGTGGACAACGACGCATAC
GAGAAGGGCCTCGCCGAGAACTATGCCTCTCTTCTTGTCGAGAACATCAAGAAGGGCGAATTCACCCACGTCATT
GCAGGCCACTCTGCCTTTGGAAAGAGCGTGTTGCCCCGCGTGGCTGCCCTCTTGGATGTGCAGCAAATCTCGGAC
ATCACCGGTATCGAGAGCGAGGACACTTTCGTCCGCCCCATCTACGCCGGTAACGCGATTCTGACCGTCCAGTCA
ACCGACAAGATCAAGGTGATCACAGTGCGAGGCACCGCCTTCCAGGACGTCGAGGTTGAGGGCGGCTCCGCCGAG
GTCGTCGACGGAGTGGACCCCAACGTTCCCGCGCTCACCGAGTGGGTGTCCGAGGAATTGGCCAAGTCAGAACGC
CCGGAGCTCGCCACAGCCACACGTGTTGTGTCTGGAGGCCGTGGCTTGAAGTCCAAGGAGGAGTTTGACCGCCTC
ATGCTTCCGCTGGCGGATTCCCTCGGCGCTGCTGTTGGTGCTTCGCGTGCTGCTGTTGACAGTGGCTTCGCCGAT
AACAGTCTGCAGGTTGGCCAGACTGGTAAGAACGTTGCTCCTCAGCTCTACCTCTGTGCCGGTATCTCCGGTGCT
ATCCAGCACTTGGCTGGTATGAAGGACAGCAAGGTCATTGCTGCTATCAACAAAGATCCCGAGGCTCCTATCTTC
CAGGTTGCTGATGTTGGCCTCGTCGGTGACTTGTTTGACAAGGTACCCGAGCTGACCGAGAAGCTCAAGAGCGCC
TAA
Gene >Pro_DTO377G3_2|g7402.t1
ATGATTCCAATCGCTAGGCACTCTGTCCTGCGGGCTGCCCGCGCTCAGCTCCAACCCACCCGGAAGCTTAGCCTG
CCCACTTCTTCGGCGCTTGCCCGCCTCCTCTCGACCCTCGCCGTCCTCGAGCAGCGCAATGGAAAGCTGGAATCT
TCGTCTTTTTCCGCAGTCGCGGCTGCACTGAAGCTCGGTGGCTCAGTAACGGGCTTCGTTGCTGGCTCTGGTGTG
AAGGCCACCTCCGCTGCCGAGGCTGCTAAGATCAAGGGTGTTGAGAAGGTGCTGGCCGTGGACAACGACGCATAC
GAGAAGGTAAATACTCTAGCAGCCTCTGAAATCAATTTCGGTAGAAGGAGCTTTGGCTAACAATTGGATTTCTTG
CATCATAGGGCCTCGCCGAGAACTATGCCTCTCTTCTTGTCGAGAACATCAAGAAGGGCGAATTCACCCACGTCA
TTGCAGGCCACTCTGCCTTTGGAAAGAGCGTGTTGCCCCGCGTGGCTGCCCTCTTGGATGTGCAGCAAATCTCGG
ACATCACCGGTATCGAGAGCGAGGACAGTATGTGACAAGAGAAAGAAGTTTGACATGTGATCCGGCAACTGACCA
TAATCCAGCTTTCGTCCGCCCCATCTACGCCGGTAACGCGATTCTGACCGTCCAGTCAACCGACAAGATCAAGGT
GATCACAGTGCGAGGCACCGCCTTCCAGGACGTCGAGGTTGAGGGCGGCTCCGCCGAGGTCGTCGACGGAGTGGA
CCCCAACGTTCCCGCGCTCACCGAGTGGGTGTCCGAGGAATTGGCCAAGTCAGAACGCCCGGAGCTCGCCACAGC
CACACGTGTTGTGTCTGGAGGCCGTGGCTTGAAGTCCAAGGAGGAGTTTGACCGCCTCATGCTTCCGCTGGCGGA
TTCCCTCGGCGCTGCTGTTGGTGCTTCGCGTGCTGCTGTTGACAGTGGCTTCGCCGATAACAGTCTGCAGGTTGG
CCAGACTGGTAAGAACGTTGCTCCTCAGCTCTACCTCTGTGCCGGTATCTCCGGTGCTATCCAGCACTTGGCTGG
TATGAAGGACAGCAAGGTCATTGCTGCTATCAACAAAGATCCCGAGGCTCCTATCTTCCAGGTTGCTGATGTTGG
CCTCGTCGGTGACTTGTTTGACAAGGTACCCGAGCTGACCGAGAAGCTCAAGAGCGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail