Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7395.t1
Gene name
Locationscaffold_23:48459..56333
Strand-
Gene length (bp)7874
Transcript length (bp)7152
Coding sequence length (bp)7152
Protein length (aa) 2384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00128 Alpha-amylase Alpha amylase, catalytic domain 5.9E-20 103 361
PF08323 Glyco_transf_5 Starch synthase catalytic domain 8.9E-16 1175 1377

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0003824 catalytic activity Yes
GO:0008150 biological_process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 1083 1105 22
2 1957 1979 22
3 1992 2009 17
4 2014 2036 22
5 2046 2068 22
6 2081 2103 22
7 2127 2149 22
8 2172 2191 19
9 2206 2228 22
10 2235 2257 22
11 2280 2302 22
12 2309 2331 22
13 2355 2374 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7395.t1
MELLTSITQYLAIVAIYIRIVQSLPYLPEEADWNLNQNQTATHPLDYSGRWDDHTYNPSPENWRFPFYTIFLDRF
VNGDPSNDNANGTQWEHILTSNEFRHGGDVLGLVDTFDYLQGMGIKGVYLAGTPYINFPWAADGYSPLDLTLLDH
HFGTIEDWRTMISEAHRRGIYVLFDNTFATMGDLIGFQGFLNKSAPINPNEYDSVWKYDRRYWDFQPGNEVESEC
PWEYPRFWNDDGTGLTTTTLGPSCRDSEFDQYGEVAAFGNYTEWEGQISKFAFVQDRLRGWRPDVLAKIKHFSCL
TITMLDIDGFRVDKALQVTLDSLGEWSEYMRDCAKQVGKDNFYIPGEIVGGNSYGSLYIGRGHQTNQTISNLTEA
FMMTNKTNKSDEDLFLRPAERSALDGAAFHYTLYRGLSRFLGLDGTFTAEGDPPVNFVDTWNGLVETNDMVNTNT
GKFDPRHLFGVTNQDVFRWPGIKNGTHKQNLGLYIASLLMPGIPILSWGEEQDFYVLENQADNYVFGRGPMSSAQ
AWQLHGCYKLGSSKYVDFPLDRSLTGCKDDSVSLDHRDPSHPVRGLIKMMFEMRQNYPALNDGWYLQQLSNQTFD
IYLPGSGGTPTETGMWSVMRSRFADAQNFDGQGQGNQSVWLVYSNDNKTVEHKFNCSSKDALISPFPAGTRVKNL
FPPFEELTLANSSTRLGFEGSKVPNGCYPNLTMPAWGFKAFVPKDNFVQPSPYVTRFSPGHDARLVPQGKSGDTV
RIGFEFSQEMDCVDITNSLTITSKALNDESPQLDTTSVSCKPITETDVVTWPGALTSVFSYEVDLGNVFPGVHRV
TLTNVTTADGNQSTGSVDHFLFRIGEINNPMVWPQLANYSRTLLFDNPSSETEPLSVMPQAPGADMWRYSLDFGA
TFSNWMTYTGFNTSIPGKNWSGTAKQAWEGEHILAQYWSKLTGSSAHWQHGDTQWAYKPPRRFPNLFIEGEFNQF
GYDAGYSNKMALSNVSGQWEIHFMAEWPVQVAFNAWGLNEDGLPDQTQVFGDIDGDNVLDQVPPVTLLSNVFNVT
IPPPSPYLSFKLSVGDGDLRVYATPTGSRWVQLAIFIVLAIVPVATALGAVFVYLKAFYQVKFNQVGVTEKRSSF
APLVSPLVSVFQKVAHRSTNPGLALTNVGPFPSENGGVVGATVNTCRRTVLIATMEYDIEDWGIKIKIGGLGVMA
QLMGKHLAHQDLIWVVPCVGGVDYPRDDPREPMVITVLGNNYQVDVQYHQLQNITYVLLDAPVFRAQSKSEPYPA
RMDDLDSAIFYSAWNQCIAEAIKRFPAIDLYHINDYHGAAAPLYLLPHTIPCCLSLHNAEFQGLWPMQTPQQNQE
VCSVYNLDHALVKKYVQFGEVFNLLHGASNYLKIHQNGFGAVGVSKKYGKRSYARYPIFWGLKNIGALPNPDPSD
IAEWDQNANNNPEDVIIDAEFEASRAALKKQAQEWAGLKVDPEAELFVFVGRWSMQKGVDLIADIFPSILDAHPK
VQLMCIGPVIDLYGRFAALKLNRLIDLYPGRVFSRPEFTALPPFIFSGAEFALIPSRDEPFGLVAVEFGRKGALG
VGSRVGGLGQMPGWWFTIESMTTKHLIQQFKMAINDALKSSQETRALMRARSGKQRFPVAQWVEDLETLQTTSIK
KHAKYSKRHDRGSWRFSRGSTLVPESIPKVSPSSDNSREQSRSRGSTVSVPPSRPITTEMRLSGPRPGLDYVPSP
TTPSFSLNMSDNEPDSDADPRRRPLSSNHLTDSRVVYTSVSDGEDLEPISGDGNDRLSPFRTPTVYFARSGASTP
ALSAGSEDGVLGRRDARASMMSLVSVDDITKEKQHYNLQKVDPFFTDVNNEYAEKFEKKLAGLNGKNSEDQLCIE
EFLEKSEKDWFNRYRDVKLGKSPLPSPAPSVFRFKVHEIGRSETPPINGPGARPNTGQFLLPNDYVPPTGVKRFM
LMKLGDWPVYSIFLAIGQILALNSYQITLLNGEIGETAEKLYILASIYLASSIIWWMVFRLVPSVYVLTIPFLIY
GLAFLFVGLTGHIQNGTSQTWLQNVGVGLYSFASSSGSIFFALNFGDEGGAPLRSWIYRATVIQGTQQLFISFLW
YWGSWMATLNQKGSEQFSLAMTDPGALLGIGLGLACFMWLLGALIFFGLPTYYRQAPGQVPTFYLSLFRRRIILW
FFYMVFISNYWLSAPYGRNWLYLWSSKHAQVWHIVLLVLLFFIFVWAAALWVFHVFSKRHAWFIPIFAVGLGAPR
WAQILWATSNIATYIPWAGGPVAGAILGRALWLWLGVLDSLQGVGFGMILLVTMTRFHVTFTLLAAQVVGSVATI
LARATAPDKLGPGDVFPDFSAGVAAGLEKADFWVCLLFMLSINVLCIFFYRKEQLAKP*
Coding >Pro_DTO377G3_2|g7395.t1
ATGGAGTTGCTCACTTCCATCACTCAATACCTTGCCATTGTTGCAATATATATACGCATTGTACAATCATTGCCA
TATCTTCCAGAGGAAGCAGACTGGAATCTCAATCAAAATCAGACAGCGACACATCCCCTCGACTACTCGGGTCGG
TGGGATGACCACACATACAACCCCTCGCCAGAGAATTGGCGATTCCCGTTTTACACGATATTTCTCGACAGATTT
GTAAATGGCGATCCGAGTAACGATAATGCAAATGGCACACAGTGGGAACACATCTTGACCTCTAACGAGTTCCGC
CATGGCGGCGACGTTCTTGGGTTGGTTGATACGTTTGATTATCTTCAGGGGATGGGGATCAAGGGCGTCTACCTC
GCTGGAACACCGTATATCAACTTTCCCTGGGCCGCGGATGGATACTCCCCGCTGGACCTGACCCTGCTGGACCAC
CACTTTGGTACAATTGAAGATTGGCGCACAATGATATCTGAGGCACATCGACGGGGAATTTATGTTCTTTTTGAT
AATACCTTTGCAACAATGGGCGATCTTATCGGCTTCCAGGGTTTCTTGAACAAGTCCGCGCCGATCAATCCCAAC
GAGTATGACTCTGTATGGAAGTATGACCGTCGATACTGGGACTTTCAGCCTGGAAATGAAGTTGAGAGTGAATGT
CCCTGGGAGTATCCTCGGTTCTGGAATGACGACGGGACCGGTTTGACCACCACAACCCTTGGTCCTTCATGTCGG
GATAGTGAATTTGATCAGTATGGAGAAGTTGCCGCCTTTGGTAACTACACCGAATGGGAAGGACAAATCTCCAAG
TTCGCATTTGTTCAGGATCGTCTACGCGGATGGCGGCCGGACGTGCTAGCCAAGATCAAACACTTTTCTTGTCTG
ACCATCACCATGCTTGATATCGACGGATTTCGCGTTGACAAAGCTCTACAAGTTACCCTTGACTCTCTTGGAGAA
TGGTCCGAGTATATGCGAGATTGCGCCAAGCAGGTGGGAAAGGACAATTTCTACATCCCCGGAGAGATTGTGGGA
GGAAACTCTTATGGCTCGCTTTATATCGGTCGCGGTCACCAGACAAATCAAACCATCTCCAATCTGACGGAAGCT
TTTATGATGACGAACAAGACAAATAAGTCAGATGAGGATCTCTTCTTGAGACCCGCGGAGAGGTCCGCATTGGAT
GGGGCGGCGTTCCACTACACGTTATATCGTGGTCTGAGCCGGTTTCTAGGTCTGGACGGCACCTTCACTGCCGAA
GGTGACCCGCCCGTCAACTTTGTGGATACCTGGAATGGTCTTGTGGAGACCAACGATATGGTCAACACGAACACC
GGTAAGTTCGATCCTCGTCACCTGTTTGGTGTCACGAATCAGGATGTCTTCAGGTGGCCAGGGATCAAAAACGGG
ACCCACAAGCAGAATTTGGGTCTGTACATCGCTTCGTTGCTCATGCCGGGAATCCCCATCCTCTCCTGGGGCGAG
GAACAGGATTTCTACGTCCTGGAAAACCAGGCTGACAACTATGTCTTCGGTCGTGGACCCATGTCATCTGCTCAG
GCATGGCAGCTACACGGATGCTACAAACTGGGATCATCGAAATACGTTGATTTCCCGCTCGACCGCTCCCTGACC
GGATGTAAAGATGATTCCGTCAGTCTCGATCACCGCGATCCTTCACACCCAGTACGAGGCCTAATCAAGATGATG
TTTGAGATGCGTCAAAATTATCCCGCTCTGAATGATGGCTGGTACCTTCAGCAATTGTCCAACCAGACGTTCGAC
ATCTACCTTCCAGGTAGTGGTGGAACACCGACAGAGACGGGGATGTGGAGTGTCATGAGATCGCGCTTTGCGGAT
GCGCAGAATTTCGATGGCCAAGGCCAGGGGAACCAGAGCGTTTGGCTGGTGTATTCTAATGACAACAAAACAGTC
GAACACAAATTCAATTGCAGCAGTAAGGATGCTTTGATCTCGCCATTCCCCGCGGGAACAAGGGTCAAAAATCTT
TTCCCGCCGTTTGAGGAATTGACGCTGGCCAACAGTTCGACTAGGCTTGGATTCGAAGGGTCTAAAGTTCCCAAC
GGGTGTTATCCCAACCTTACTATGCCGGCCTGGGGTTTCAAAGCCTTTGTCCCGAAGGATAACTTCGTCCAGCCT
TCCCCGTATGTAACCCGCTTCTCCCCAGGGCATGACGCTCGGCTTGTGCCCCAGGGAAAAAGTGGGGATACAGTT
CGCATTGGCTTCGAATTCTCTCAGGAGATGGACTGCGTGGATATCACGAACTCGCTAACGATAACGTCAAAAGCG
CTTAACGACGAGAGCCCACAACTTGACACTACCTCGGTCTCTTGTAAACCAATTACAGAGACTGATGTTGTGACA
TGGCCCGGGGCACTCACTAGCGTTTTCAGCTACGAAGTAGATTTGGGCAATGTCTTCCCAGGGGTTCACAGAGTC
ACACTTACCAATGTGACTACAGCAGATGGAAATCAATCCACAGGTTCCGTTGACCACTTTCTTTTCCGTATCGGA
GAGATAAACAATCCGATGGTCTGGCCACAGTTGGCCAACTACAGTAGAACGCTATTGTTCGACAACCCGTCGTCT
GAAACTGAACCCTTATCAGTAATGCCACAGGCCCCTGGTGCAGACATGTGGCGTTACTCGCTGGATTTTGGAGCT
ACATTCAGTAACTGGATGACATACACCGGCTTCAACACTTCGATCCCCGGCAAAAACTGGTCCGGCACTGCGAAG
CAGGCCTGGGAAGGAGAACACATCCTTGCCCAATACTGGAGCAAGTTGACCGGAAGTAGCGCTCACTGGCAACAT
GGAGACACGCAATGGGCATACAAGCCCCCACGTCGCTTCCCAAACCTCTTCATCGAAGGCGAGTTCAACCAGTTC
GGATATGACGCTGGCTATTCCAACAAAATGGCTCTCAGCAACGTAAGTGGCCAGTGGGAAATCCACTTCATGGCT
GAATGGCCCGTGCAAGTTGCATTCAACGCCTGGGGGTTGAACGAAGACGGCTTGCCCGATCAGACACAGGTATTT
GGGGACATTGACGGAGACAATGTCCTGGATCAGGTCCCTCCAGTCACGCTTCTGAGCAATGTGTTCAACGTTACA
ATTCCACCCCCTTCGCCCTATCTTTCCTTCAAGCTATCGGTGGGTGACGGCGATCTTAGGGTCTACGCTACGCCT
ACTGGATCCAGGTGGGTTCAGCTGGCCATCTTTATTGTGCTAGCAATTGTGCCTGTCGCTACCGCTCTCGGCGCG
GTTTTTGTTTATCTGAAGGCCTTTTACCAGGTCAAATTCAATCAAGTCGGTGTGACCGAGAAAAGATCAAGTTTC
GCTCCGCTGGTGAGTCCACTGGTGAGCGTCTTTCAAAAGGTGGCTCATCGATCTACGAACCCCGGACTTGCCCTC
ACCAATGTGGGCCCGTTTCCATCTGAAAATGGAGGCGTCGTTGGTGCCACGGTAAACACCTGCCGACGAACCGTG
CTCATTGCAACAATGGAATACGATATTGAAGATTGGGGCATTAAGATCAAGATCGGTGGGCTCGGTGTGATGGCC
CAGCTGATGGGAAAACATCTAGCCCACCAGGACCTCATCTGGGTGGTCCCTTGTGTTGGAGGAGTTGACTACCCT
AGGGACGACCCTCGTGAGCCGATGGTAATCACCGTTCTTGGGAATAACTACCAAGTGGATGTCCAGTATCATCAG
CTGCAAAACATCACGTACGTCTTGTTAGATGCGCCTGTGTTCCGAGCTCAATCCAAATCAGAGCCGTACCCTGCC
CGCATGGATGATCTGGATTCGGCTATATTCTATTCTGCTTGGAATCAATGTATTGCCGAGGCCATCAAGAGATTT
CCGGCTATCGACCTCTATCATATCAATGATTACCATGGCGCTGCTGCCCCTCTCTATCTTCTACCTCACACAATC
CCATGCTGCCTATCTCTGCATAACGCCGAATTTCAAGGACTCTGGCCGATGCAAACTCCACAACAAAATCAAGAG
GTTTGCAGTGTCTATAACCTTGACCATGCATTGGTAAAGAAGTATGTCCAATTCGGAGAGGTGTTCAACCTTCTA
CATGGAGCTTCCAACTATCTGAAAATCCACCAGAACGGATTCGGCGCTGTCGGTGTCTCCAAGAAATATGGCAAG
CGATCGTACGCCAGATATCCTATTTTCTGGGGTCTCAAGAACATTGGAGCGCTTCCAAACCCCGATCCATCTGAC
ATCGCCGAGTGGGATCAAAACGCAAACAACAACCCCGAAGACGTTATTATTGACGCTGAGTTTGAAGCCAGTCGT
GCCGCACTCAAGAAACAAGCACAAGAATGGGCAGGGCTTAAAGTTGACCCAGAGGCCGAGCTGTTTGTGTTTGTC
GGTCGTTGGTCTATGCAAAAGGGCGTTGATCTGATTGCAGACATCTTCCCCTCCATTTTAGACGCCCACCCAAAG
GTTCAGTTGATGTGCATTGGTCCAGTAATTGATCTCTATGGAAGATTTGCTGCGTTGAAATTGAATCGACTCATA
GATCTCTATCCTGGGCGAGTCTTTTCCAGACCAGAGTTCACTGCACTACCGCCCTTCATTTTCAGTGGTGCAGAA
TTTGCCTTGATTCCTTCGCGCGATGAACCGTTCGGTTTGGTGGCCGTGGAATTCGGACGGAAAGGAGCTTTGGGC
GTGGGATCACGTGTTGGTGGCCTTGGGCAGATGCCAGGATGGTGGTTCACAATCGAGTCTATGACAACCAAACAT
CTTATTCAGCAGTTCAAGATGGCCATCAATGACGCTCTGAAATCGTCGCAGGAGACACGAGCTCTCATGCGTGCA
CGATCCGGCAAGCAGCGTTTCCCCGTAGCACAGTGGGTTGAGGATCTGGAAACGCTACAAACCACCTCAATCAAA
AAGCACGCCAAGTACTCTAAGCGCCACGATCGTGGTTCATGGAGATTTTCCCGTGGCAGCACTCTTGTCCCAGAA
AGCATCCCTAAAGTCTCGCCGAGCTCAGACAACAGCCGCGAACAGAGCAGATCACGCGGCTCCACCGTATCTGTC
CCACCGAGTAGGCCGATTACGACTGAGATGAGACTGTCTGGACCTCGACCAGGCCTTGACTATGTTCCCTCGCCG
ACAACTCCGTCTTTCAGTCTTAACATGTCCGACAACGAGCCTGATTCTGACGCCGACCCAAGACGCAGACCTTTG
TCCTCCAACCATCTCACAGACTCGCGAGTCGTTTACACCTCGGTAAGCGATGGAGAAGATCTCGAGCCTATTTCC
GGGGACGGCAATGATCGTCTATCGCCATTTAGGACACCTACCGTTTATTTTGCTCGATCCGGTGCCAGCACACCA
GCTCTCAGTGCAGGATCAGAAGACGGTGTGCTGGGCCGAAGAGATGCAAGGGCGTCTATGATGAGTCTGGTCAGC
GTGGATGATATAACAAAGGAGAAACAACACTACAATCTCCAGAAAGTTGATCCATTTTTCACGGATGTGAATAAC
GAGTACGCGGAGAAGTTTGAGAAGAAGCTTGCAGGCCTGAATGGCAAGAATTCCGAAGACCAGCTCTGCATCGAG
GAGTTTCTCGAGAAGAGTGAAAAAGACTGGTTCAATCGATACCGCGACGTCAAGCTGGGCAAGTCCCCCTTGCCA
TCTCCTGCTCCCTCTGTCTTTCGTTTCAAGGTTCATGAAATCGGTCGCTCAGAGACCCCGCCAATTAATGGTCCA
GGTGCAAGGCCCAATACTGGGCAATTCCTTCTCCCAAATGACTATGTTCCCCCCACGGGTGTGAAGCGTTTCATG
TTGATGAAGCTGGGTGATTGGCCTGTGTACTCCATCTTCCTCGCTATTGGCCAAATTCTCGCCTTGAATTCGTAC
CAGATCACACTCCTGAACGGTGAGATTGGAGAGACGGCCGAGAAGCTATACATTCTGGCATCCATCTATCTTGCC
TCTTCTATCATATGGTGGATGGTCTTCCGTCTAGTCCCCTCAGTCTACGTGTTGACGATTCCTTTCCTTATATAC
GGGCTCGCCTTTCTATTTGTCGGTCTTACCGGTCACATCCAAAACGGCACAAGTCAAACATGGCTACAAAATGTG
GGAGTCGGCTTGTATTCGTTTGCGTCTTCGAGTGGTTCGATTTTCTTCGCCCTCAACTTTGGAGACGAAGGTGGA
GCGCCTCTGAGGTCTTGGATTTACAGGGCCACTGTCATCCAGGGCACCCAGCAATTGTTCATCAGTTTCCTTTGG
TACTGGGGTAGCTGGATGGCAACTCTCAATCAAAAAGGTAGTGAGCAATTCAGCCTTGCCATGACCGATCCAGGT
GCTTTGCTCGGAATCGGACTCGGACTCGCCTGTTTTATGTGGCTGTTGGGAGCCCTGATCTTCTTTGGACTTCCT
ACATATTACCGACAAGCACCAGGTCAAGTGCCGACATTCTACCTATCGCTCTTCCGTCGTCGCATTATTCTTTGG
TTTTTCTACATGGTGTTTATATCGAACTACTGGCTGTCGGCACCGTACGGACGGAACTGGCTCTATCTCTGGTCC
AGCAAGCATGCACAGGTGTGGCATATCGTGCTCCTTGTTCTCCTCTTTTTCATCTTTGTCTGGGCGGCAGCTCTC
TGGGTCTTTCACGTCTTTTCCAAGAGACACGCCTGGTTTATCCCGATCTTTGCTGTCGGTCTTGGTGCTCCTCGA
TGGGCCCAGATCCTGTGGGCGACCTCCAACATAGCCACATACATCCCCTGGGCCGGTGGTCCCGTAGCCGGAGCT
ATCCTTGGTAGAGCGCTATGGCTCTGGCTAGGAGTTTTGGATTCCCTTCAGGGTGTCGGGTTTGGAATGATCCTC
CTCGTCACAATGACTCGATTCCATGTCACCTTCACACTTCTAGCCGCGCAGGTGGTCGGTTCCGTTGCGACTATC
CTCGCCCGCGCGACAGCACCGGATAAGTTAGGCCCTGGTGATGTCTTCCCTGATTTCTCGGCTGGGGTCGCAGCC
GGCTTGGAAAAGGCAGACTTCTGGGTGTGCCTGCTCTTCATGCTGTCCATCAATGTGCTCTGCATCTTCTTCTAT
CGCAAGGAACAACTTGCGAAACCTTGA
Transcript >Pro_DTO377G3_2|g7395.t1
ATGGAGTTGCTCACTTCCATCACTCAATACCTTGCCATTGTTGCAATATATATACGCATTGTACAATCATTGCCA
TATCTTCCAGAGGAAGCAGACTGGAATCTCAATCAAAATCAGACAGCGACACATCCCCTCGACTACTCGGGTCGG
TGGGATGACCACACATACAACCCCTCGCCAGAGAATTGGCGATTCCCGTTTTACACGATATTTCTCGACAGATTT
GTAAATGGCGATCCGAGTAACGATAATGCAAATGGCACACAGTGGGAACACATCTTGACCTCTAACGAGTTCCGC
CATGGCGGCGACGTTCTTGGGTTGGTTGATACGTTTGATTATCTTCAGGGGATGGGGATCAAGGGCGTCTACCTC
GCTGGAACACCGTATATCAACTTTCCCTGGGCCGCGGATGGATACTCCCCGCTGGACCTGACCCTGCTGGACCAC
CACTTTGGTACAATTGAAGATTGGCGCACAATGATATCTGAGGCACATCGACGGGGAATTTATGTTCTTTTTGAT
AATACCTTTGCAACAATGGGCGATCTTATCGGCTTCCAGGGTTTCTTGAACAAGTCCGCGCCGATCAATCCCAAC
GAGTATGACTCTGTATGGAAGTATGACCGTCGATACTGGGACTTTCAGCCTGGAAATGAAGTTGAGAGTGAATGT
CCCTGGGAGTATCCTCGGTTCTGGAATGACGACGGGACCGGTTTGACCACCACAACCCTTGGTCCTTCATGTCGG
GATAGTGAATTTGATCAGTATGGAGAAGTTGCCGCCTTTGGTAACTACACCGAATGGGAAGGACAAATCTCCAAG
TTCGCATTTGTTCAGGATCGTCTACGCGGATGGCGGCCGGACGTGCTAGCCAAGATCAAACACTTTTCTTGTCTG
ACCATCACCATGCTTGATATCGACGGATTTCGCGTTGACAAAGCTCTACAAGTTACCCTTGACTCTCTTGGAGAA
TGGTCCGAGTATATGCGAGATTGCGCCAAGCAGGTGGGAAAGGACAATTTCTACATCCCCGGAGAGATTGTGGGA
GGAAACTCTTATGGCTCGCTTTATATCGGTCGCGGTCACCAGACAAATCAAACCATCTCCAATCTGACGGAAGCT
TTTATGATGACGAACAAGACAAATAAGTCAGATGAGGATCTCTTCTTGAGACCCGCGGAGAGGTCCGCATTGGAT
GGGGCGGCGTTCCACTACACGTTATATCGTGGTCTGAGCCGGTTTCTAGGTCTGGACGGCACCTTCACTGCCGAA
GGTGACCCGCCCGTCAACTTTGTGGATACCTGGAATGGTCTTGTGGAGACCAACGATATGGTCAACACGAACACC
GGTAAGTTCGATCCTCGTCACCTGTTTGGTGTCACGAATCAGGATGTCTTCAGGTGGCCAGGGATCAAAAACGGG
ACCCACAAGCAGAATTTGGGTCTGTACATCGCTTCGTTGCTCATGCCGGGAATCCCCATCCTCTCCTGGGGCGAG
GAACAGGATTTCTACGTCCTGGAAAACCAGGCTGACAACTATGTCTTCGGTCGTGGACCCATGTCATCTGCTCAG
GCATGGCAGCTACACGGATGCTACAAACTGGGATCATCGAAATACGTTGATTTCCCGCTCGACCGCTCCCTGACC
GGATGTAAAGATGATTCCGTCAGTCTCGATCACCGCGATCCTTCACACCCAGTACGAGGCCTAATCAAGATGATG
TTTGAGATGCGTCAAAATTATCCCGCTCTGAATGATGGCTGGTACCTTCAGCAATTGTCCAACCAGACGTTCGAC
ATCTACCTTCCAGGTAGTGGTGGAACACCGACAGAGACGGGGATGTGGAGTGTCATGAGATCGCGCTTTGCGGAT
GCGCAGAATTTCGATGGCCAAGGCCAGGGGAACCAGAGCGTTTGGCTGGTGTATTCTAATGACAACAAAACAGTC
GAACACAAATTCAATTGCAGCAGTAAGGATGCTTTGATCTCGCCATTCCCCGCGGGAACAAGGGTCAAAAATCTT
TTCCCGCCGTTTGAGGAATTGACGCTGGCCAACAGTTCGACTAGGCTTGGATTCGAAGGGTCTAAAGTTCCCAAC
GGGTGTTATCCCAACCTTACTATGCCGGCCTGGGGTTTCAAAGCCTTTGTCCCGAAGGATAACTTCGTCCAGCCT
TCCCCGTATGTAACCCGCTTCTCCCCAGGGCATGACGCTCGGCTTGTGCCCCAGGGAAAAAGTGGGGATACAGTT
CGCATTGGCTTCGAATTCTCTCAGGAGATGGACTGCGTGGATATCACGAACTCGCTAACGATAACGTCAAAAGCG
CTTAACGACGAGAGCCCACAACTTGACACTACCTCGGTCTCTTGTAAACCAATTACAGAGACTGATGTTGTGACA
TGGCCCGGGGCACTCACTAGCGTTTTCAGCTACGAAGTAGATTTGGGCAATGTCTTCCCAGGGGTTCACAGAGTC
ACACTTACCAATGTGACTACAGCAGATGGAAATCAATCCACAGGTTCCGTTGACCACTTTCTTTTCCGTATCGGA
GAGATAAACAATCCGATGGTCTGGCCACAGTTGGCCAACTACAGTAGAACGCTATTGTTCGACAACCCGTCGTCT
GAAACTGAACCCTTATCAGTAATGCCACAGGCCCCTGGTGCAGACATGTGGCGTTACTCGCTGGATTTTGGAGCT
ACATTCAGTAACTGGATGACATACACCGGCTTCAACACTTCGATCCCCGGCAAAAACTGGTCCGGCACTGCGAAG
CAGGCCTGGGAAGGAGAACACATCCTTGCCCAATACTGGAGCAAGTTGACCGGAAGTAGCGCTCACTGGCAACAT
GGAGACACGCAATGGGCATACAAGCCCCCACGTCGCTTCCCAAACCTCTTCATCGAAGGCGAGTTCAACCAGTTC
GGATATGACGCTGGCTATTCCAACAAAATGGCTCTCAGCAACGTAAGTGGCCAGTGGGAAATCCACTTCATGGCT
GAATGGCCCGTGCAAGTTGCATTCAACGCCTGGGGGTTGAACGAAGACGGCTTGCCCGATCAGACACAGGTATTT
GGGGACATTGACGGAGACAATGTCCTGGATCAGGTCCCTCCAGTCACGCTTCTGAGCAATGTGTTCAACGTTACA
ATTCCACCCCCTTCGCCCTATCTTTCCTTCAAGCTATCGGTGGGTGACGGCGATCTTAGGGTCTACGCTACGCCT
ACTGGATCCAGGTGGGTTCAGCTGGCCATCTTTATTGTGCTAGCAATTGTGCCTGTCGCTACCGCTCTCGGCGCG
GTTTTTGTTTATCTGAAGGCCTTTTACCAGGTCAAATTCAATCAAGTCGGTGTGACCGAGAAAAGATCAAGTTTC
GCTCCGCTGGTGAGTCCACTGGTGAGCGTCTTTCAAAAGGTGGCTCATCGATCTACGAACCCCGGACTTGCCCTC
ACCAATGTGGGCCCGTTTCCATCTGAAAATGGAGGCGTCGTTGGTGCCACGGTAAACACCTGCCGACGAACCGTG
CTCATTGCAACAATGGAATACGATATTGAAGATTGGGGCATTAAGATCAAGATCGGTGGGCTCGGTGTGATGGCC
CAGCTGATGGGAAAACATCTAGCCCACCAGGACCTCATCTGGGTGGTCCCTTGTGTTGGAGGAGTTGACTACCCT
AGGGACGACCCTCGTGAGCCGATGGTAATCACCGTTCTTGGGAATAACTACCAAGTGGATGTCCAGTATCATCAG
CTGCAAAACATCACGTACGTCTTGTTAGATGCGCCTGTGTTCCGAGCTCAATCCAAATCAGAGCCGTACCCTGCC
CGCATGGATGATCTGGATTCGGCTATATTCTATTCTGCTTGGAATCAATGTATTGCCGAGGCCATCAAGAGATTT
CCGGCTATCGACCTCTATCATATCAATGATTACCATGGCGCTGCTGCCCCTCTCTATCTTCTACCTCACACAATC
CCATGCTGCCTATCTCTGCATAACGCCGAATTTCAAGGACTCTGGCCGATGCAAACTCCACAACAAAATCAAGAG
GTTTGCAGTGTCTATAACCTTGACCATGCATTGGTAAAGAAGTATGTCCAATTCGGAGAGGTGTTCAACCTTCTA
CATGGAGCTTCCAACTATCTGAAAATCCACCAGAACGGATTCGGCGCTGTCGGTGTCTCCAAGAAATATGGCAAG
CGATCGTACGCCAGATATCCTATTTTCTGGGGTCTCAAGAACATTGGAGCGCTTCCAAACCCCGATCCATCTGAC
ATCGCCGAGTGGGATCAAAACGCAAACAACAACCCCGAAGACGTTATTATTGACGCTGAGTTTGAAGCCAGTCGT
GCCGCACTCAAGAAACAAGCACAAGAATGGGCAGGGCTTAAAGTTGACCCAGAGGCCGAGCTGTTTGTGTTTGTC
GGTCGTTGGTCTATGCAAAAGGGCGTTGATCTGATTGCAGACATCTTCCCCTCCATTTTAGACGCCCACCCAAAG
GTTCAGTTGATGTGCATTGGTCCAGTAATTGATCTCTATGGAAGATTTGCTGCGTTGAAATTGAATCGACTCATA
GATCTCTATCCTGGGCGAGTCTTTTCCAGACCAGAGTTCACTGCACTACCGCCCTTCATTTTCAGTGGTGCAGAA
TTTGCCTTGATTCCTTCGCGCGATGAACCGTTCGGTTTGGTGGCCGTGGAATTCGGACGGAAAGGAGCTTTGGGC
GTGGGATCACGTGTTGGTGGCCTTGGGCAGATGCCAGGATGGTGGTTCACAATCGAGTCTATGACAACCAAACAT
CTTATTCAGCAGTTCAAGATGGCCATCAATGACGCTCTGAAATCGTCGCAGGAGACACGAGCTCTCATGCGTGCA
CGATCCGGCAAGCAGCGTTTCCCCGTAGCACAGTGGGTTGAGGATCTGGAAACGCTACAAACCACCTCAATCAAA
AAGCACGCCAAGTACTCTAAGCGCCACGATCGTGGTTCATGGAGATTTTCCCGTGGCAGCACTCTTGTCCCAGAA
AGCATCCCTAAAGTCTCGCCGAGCTCAGACAACAGCCGCGAACAGAGCAGATCACGCGGCTCCACCGTATCTGTC
CCACCGAGTAGGCCGATTACGACTGAGATGAGACTGTCTGGACCTCGACCAGGCCTTGACTATGTTCCCTCGCCG
ACAACTCCGTCTTTCAGTCTTAACATGTCCGACAACGAGCCTGATTCTGACGCCGACCCAAGACGCAGACCTTTG
TCCTCCAACCATCTCACAGACTCGCGAGTCGTTTACACCTCGGTAAGCGATGGAGAAGATCTCGAGCCTATTTCC
GGGGACGGCAATGATCGTCTATCGCCATTTAGGACACCTACCGTTTATTTTGCTCGATCCGGTGCCAGCACACCA
GCTCTCAGTGCAGGATCAGAAGACGGTGTGCTGGGCCGAAGAGATGCAAGGGCGTCTATGATGAGTCTGGTCAGC
GTGGATGATATAACAAAGGAGAAACAACACTACAATCTCCAGAAAGTTGATCCATTTTTCACGGATGTGAATAAC
GAGTACGCGGAGAAGTTTGAGAAGAAGCTTGCAGGCCTGAATGGCAAGAATTCCGAAGACCAGCTCTGCATCGAG
GAGTTTCTCGAGAAGAGTGAAAAAGACTGGTTCAATCGATACCGCGACGTCAAGCTGGGCAAGTCCCCCTTGCCA
TCTCCTGCTCCCTCTGTCTTTCGTTTCAAGGTTCATGAAATCGGTCGCTCAGAGACCCCGCCAATTAATGGTCCA
GGTGCAAGGCCCAATACTGGGCAATTCCTTCTCCCAAATGACTATGTTCCCCCCACGGGTGTGAAGCGTTTCATG
TTGATGAAGCTGGGTGATTGGCCTGTGTACTCCATCTTCCTCGCTATTGGCCAAATTCTCGCCTTGAATTCGTAC
CAGATCACACTCCTGAACGGTGAGATTGGAGAGACGGCCGAGAAGCTATACATTCTGGCATCCATCTATCTTGCC
TCTTCTATCATATGGTGGATGGTCTTCCGTCTAGTCCCCTCAGTCTACGTGTTGACGATTCCTTTCCTTATATAC
GGGCTCGCCTTTCTATTTGTCGGTCTTACCGGTCACATCCAAAACGGCACAAGTCAAACATGGCTACAAAATGTG
GGAGTCGGCTTGTATTCGTTTGCGTCTTCGAGTGGTTCGATTTTCTTCGCCCTCAACTTTGGAGACGAAGGTGGA
GCGCCTCTGAGGTCTTGGATTTACAGGGCCACTGTCATCCAGGGCACCCAGCAATTGTTCATCAGTTTCCTTTGG
TACTGGGGTAGCTGGATGGCAACTCTCAATCAAAAAGGTAGTGAGCAATTCAGCCTTGCCATGACCGATCCAGGT
GCTTTGCTCGGAATCGGACTCGGACTCGCCTGTTTTATGTGGCTGTTGGGAGCCCTGATCTTCTTTGGACTTCCT
ACATATTACCGACAAGCACCAGGTCAAGTGCCGACATTCTACCTATCGCTCTTCCGTCGTCGCATTATTCTTTGG
TTTTTCTACATGGTGTTTATATCGAACTACTGGCTGTCGGCACCGTACGGACGGAACTGGCTCTATCTCTGGTCC
AGCAAGCATGCACAGGTGTGGCATATCGTGCTCCTTGTTCTCCTCTTTTTCATCTTTGTCTGGGCGGCAGCTCTC
TGGGTCTTTCACGTCTTTTCCAAGAGACACGCCTGGTTTATCCCGATCTTTGCTGTCGGTCTTGGTGCTCCTCGA
TGGGCCCAGATCCTGTGGGCGACCTCCAACATAGCCACATACATCCCCTGGGCCGGTGGTCCCGTAGCCGGAGCT
ATCCTTGGTAGAGCGCTATGGCTCTGGCTAGGAGTTTTGGATTCCCTTCAGGGTGTCGGGTTTGGAATGATCCTC
CTCGTCACAATGACTCGATTCCATGTCACCTTCACACTTCTAGCCGCGCAGGTGGTCGGTTCCGTTGCGACTATC
CTCGCCCGCGCGACAGCACCGGATAAGTTAGGCCCTGGTGATGTCTTCCCTGATTTCTCGGCTGGGGTCGCAGCC
GGCTTGGAAAAGGCAGACTTCTGGGTGTGCCTGCTCTTCATGCTGTCCATCAATGTGCTCTGCATCTTCTTCTAT
CGCAAGGAACAACTTGCGAAACCTTGA
Gene >Pro_DTO377G3_2|g7395.t1
ATGGAGTTGCTCACTTCCATCACTCAATACCTTGCCATTGTTGCAATATATATACGCATTGTACAATCATTGCCA
TATCTTCCAGAGGAAGCAGACTGGAATCTCAATCAAAATCAGACAGCGACACATCCCCTCGACTACTCGGGTCGG
TGGGATGACCACACATACAACCCCTCGCCAGAGAATTGGCGATTCCCGTTTTACACGATATTTCTCGACAGATTT
GTAAATGGCGATCCGAGTAACGATAATGCAAATGGCACACAGTGGGAACACATCTTGACCTCTAACGAGTTCCGC
CATGGCGGCGACGTTCTTGGGTTGGTTGATACGTTTGATTATCTTCAGGGGATGGGGATCAAGGTGCGCTTTTTT
GCTTCCGGAAGATTGGACGTGGAAAATATATTAACCATATCCAGGGCGTCTACCTCGCTGGAACACCGTATATCA
ACTTTCCCTGGGCCGCGGATGGATACTCCCCGCTGGACCTGACCCTGCTGGACCACCACTTTGGTACAATTGAAG
ATTGGCGCACAATGATATCTGAGGCACATCGACGGGGAATTTATGTTCTTTTTGATAATACCTTTGCAACGTATG
TGGGATCTATCTGCGCAACCTCCGATGTCGTCTGCTGATTTTGCATAGAATGGGCGATCTTATCGGCTTCCAGGG
TTTCTTGAACAAGTCCGCGCCGATCAATCCCAACGAGTATGACTCTGTATGGAAGTATGACCGTCGATACTGGGA
CTTTCAGCCTGGAAATGAAGTTGAGAGTGAATGTCCCTGGGAGTATCCTCGGTTCTGGAATGACGACGGGACCGG
TTTGACCACCACAACCCTTGGTCCTTCATGTCGGGATAGTGAATTTGATCAGGTAACATTCCCTTTCTTTCGACA
TTGAACATGACTGACCCCTACAGTATGGAGAAGTTGCCGCCTTTGGTAACTACACCGAATGGGAAGGACAAATCT
CCAAGTTCGCATTTGTTCAGGATCGTCTACGCGGATGGCGGCCGGACGTGCTAGCCAAGATCAAACACTTTTCTT
GTCTGACCATCACCATGCTTGATATCGACGGATTTCGCGTTGACAAAGCTCTACAAGTTACCCTTGACTCTCTTG
GAGAATGGTCCGAGTATATGCGAGATTGCGCCAAGCAGGTGGGAAAGGACAATTTCTACATCCCCGGAGAGATTG
TGGGAGGAAACTCTTATGGCTCGCTTTATATCGGTCGCGGTCACCAGACAAATCAAACCATCTCCAATCTGACGG
AAGCTTTTATGATGACGAACAAGACAAATAAGTCAGATGAGGATCTCTTCTTGAGACCCGCGGAGAGGTCCGCAT
TGGATGGGGCGGCGTTCCACTACACGTTATATCGTGGTCTGAGCCGGTTTCTAGGGTTAGTTTCTTCCTTTCACC
ACTTTCAGTTTACTCAAGCTAACATCGTCCCGTTCAGTCTGGACGGCACCTTCACTGCCGAAGGTGACCCGCCCG
TCAACTTTGTGGATACCTGGAATGGTCTTGTGGAGACCAACGATATGGTCAACACGAACACCGGTAAGTTCGATC
CTCGTCACCTGTTTGGTGTCACGAATCAGGATGTCTTCAGGTGGCCAGGGATCAAAAACGGGACCCACAAGCAGA
ATTTGGGTCTGTACATCGCTTCGTTGCTCATGCCGGGAATCCCCATCCTCTCCTGGGGCGAGGAACAGGATTTCT
ACGTCCTGGAAAACCAGGCTGACAACTATGTCTTCGGTCGTGGACCCATGTCATCTGCTCAGGCATGGCAGCTAC
ACGGATGCTACAAACTGGGATCATCGAAATACGTTGATTTCCCGCTCGACCGCTCCCTGACCGGATGTAAAGATG
ATTCCGTCAGTCTCGATCACCGCGATCCTTCACACCCAGTACGAGGCCTAATCAAGATGATGTTTGAGATGCGTC
AAAATTATCCCGCTCTGAATGATGGCTGGTACCTTCAGCAATTGTCCAACCAGACGTTCGACATCTACCTTCCAG
GTAGTGGTGGAACACCGACAGAGACGGGGATGTGGAGTGTCATGAGATCGCGCTTTGCGGATGCGCAGAATTTCG
ATGGCCAAGGCCAGGGGAACCAGAGCGTTTGGCTGGTGTATTCTAATGACAACAAAACAGTCGAACACAAATTCA
ATTGCAGCAGTAAGGATGCTTTGATCTCGCCATTCCCCGCGGGAACAAGGGTCAAAAATCTTTTCCCGCCGTTTG
AGGAATTGACGCTGGCCAACAGTTCGACTAGGCTTGGGTATGATTGCTATTCTGAGATTGATTGCTGTTACTGAC
AATGAGCAGATTCGAAGGGTCTAAAGTTCCCAACGGGTGTTATCCCAACCTTACTATGCCGGCCTGGGGTTTCAA
AGCCTTTGTCCCGAAGGATAACTTCGTCCAGCCTTCCCCGTATGTAACCCGCTTCTCCCCAGGGCATGACGCTCG
GCTTGTGCCCCAGGGAAAAAGTGGGGATACAGTTCGCATTGGCTTCGAATTCTCTCAGGAGATGGACTGCGTGGA
TATCACGAACTCGCTAACGATAACGTCAAAAGCGCTTAACGACGAGAGCCCACAACTTGACACTACCTCGGTCTC
TTGTAAACCAATTACAGAGACTGATGTTGTGACATGGCCCGGGGCACTCACTAGCGTTTTCAGCTACGAAGTAGA
TTTGGGCAATGTCTTCCCAGGGGTTCACAGAGTCACACTTACCAATGTGACTACAGCAGATGGAAATCAATCCAC
AGGTGTGAGTAAATTCCTCGCTATACAGATTAAGAAAGTCTCAATACTAATTGAGGCAGTCCGTTGACCACTTTC
TTTTCCGTATCGGAGAGATAAACAATCCGATGGTCTGGCCACAGTTGGCCAACTACAGTAGAACGCTATTGTTCG
ACAACCCGTCGTCTGAAACTGAACCCTTATCAGTAATGCCACAGGCCCCTGGTGCAGACATGTGGCGTTACTCGC
TGGATTTTGGAGCTACATTCAGTAACTGGATGACATACACCGGCTTCAACACTTCGATCCCCGGCAAAAACTGGT
CCGGCACTGCGAAGCAGGCCTGGGAAGGAGAACACATCCTTGCCCAATACTGGAGCAAGTTGACCGGAAGTAGCG
CTCACTGGCAACATGGAGACACGCAATGGGCATACAAGCCCCCACGTCGCTTCCCAAACCTCTTCATCGAAGGCG
AGTTCAACCAGTTCGGATATGACGCTGGCTATTCCAACAAAATGGCTCTCAGCAACGTAAGTGGCCAGTGGGAAA
TCCACTTCATGGCTGAATGGCCCGTGCAAGTTGCATTCAACGCCTGGGGGTTGAACGAAGACGGCTTGCCCGATC
AGACACAGGTATTTGGGGACATTGACGGAGACAATGTCCTGGATCAGGTCCCTCCAGTCACGCTTCTGAGCAATG
TGTTCAACGTTACAATTCCACCCCCTTCGCCCTATCTTTCCTTCAAGCTATCGGTGGGTGACGGCGATCTTAGGG
TCTACGCTACGCCTACTGGATCCAGGTGGGTTCAGCTGGCCATCTTTATTGTGCTAGCAATTGTGCCTGTCGCTA
CCGCTCTCGGCGCGGTTTTTGTTTATCTGAAGGCCTTTTACCAGGTCAAATTCAATCAAGTCGGTGTGACCGAGA
AAAGATCAAGTTTCGCTCCGCTGGTGAGTCCACTGGTGAGCGTCTTTCAAAAGGTGGCTCATCGATCTACGAACC
CCGGACTTGCCCTCACCAATGTGGGCCCGTTTCCATCTGAAAATGGAGGCGTCGTTGGTGCCACGGTAAACACCT
GCCGACGAACCGTGCTCATTGCAACAATGGAATACGATATTGAAGATTGGGGCATTAAGATCAAGATCGGTGGGC
TCGGTGTGATGGCCCAGCTGATGGGAAAACATCTAGCCCACCAGGACCTCATCTGGGTGGTCCCTTGTGTTGGAG
GAGTTGACTACCCTAGGGACGACCCTCGTGAGCCGATGGTAATCACCGTTCTTGGGAATAACTACCAAGTGGATG
TCCAGTATCATCAGCTGCAAAACATCACGTACGTCTTGTTAGATGCGCCTGTGTTCCGAGCTCAATCCAAATCAG
AGCCGTACCCTGCCCGCATGGATGATCTGGATTCGGCTATATTCTATTCTGCTTGGAATCAATGTATTGCCGAGG
CCATCAAGAGATTTCCGGCTATCGACCTCTATCATATCAATGATTACCATGGCGCTGCTGCCCCTCTCTATCTTC
TACCTCACACAATCCCATGCTGCCTATCTCTGCATAACGCCGAATTTCAAGGACTCTGGCCGATGCAAACTCCAC
AACAAAATCAAGAGGTTTGCAGTGTCTATAACCTTGACCATGCATTGGTAAAGAAGTATGTCCAATTCGGAGAGG
TGTTCAACCTTCTACATGGAGCTTCCAACTATCTGAAAATCCACCAGAACGGATTCGGCGCTGTCGGTGTCTCCA
AGAAATATGGCAAGCGATCGTACGCCAGATATCCTATTTTCTGGGGTCTCAAGAACATTGGAGCGCTTCCAAACC
CCGATCCATCTGACATCGCCGAGTGGGATCAAAACGCAAACAACAACCCCGAAGACGTTATTATTGACGCTGAGT
TTGAAGCCAGTCGTGCCGCACTCAAGAAACAAGCACAAGAATGGGCAGGGCTTAAAGTTGACCCAGAGGCCGAGC
TGTTTGTGTTTGTCGGTCGTTGGTCTATGCAAAAGGGCGTTGATCTGATTGCAGACATCTTCCCCTCCATTTTAG
ACGCCCACCCAAAGGTTCAGTTGATGTGCATTGGTCCAGTAATTGATCTCTATGGAAGATTTGCTGCGTTGAAAT
TGAATCGACTCATAGATCTCTATCCTGGGCGAGTCTTTTCCAGACCAGAGTTCACTGCACTACCGCCCTTCATTT
TCAGTGGTGCAGAATTTGCCTTGATTCCTTCGCGCGATGAACCGTTCGGTTTGGTGGCCGTGGAATTCGGACGGA
AAGGAGCTTTGGGCGTGGGATCACGGTAAGACTTACCTGGCTTGAATCTACCAACAGTGCTAACTTATGTTCCTT
TTTTAGTGTTGGTGGCCTTGGGCAGATGCCAGGATGGTGGTTCACAATGTGAGTTTCCTTCTCTCTCTCTCTCTC
TCTCTCTCTCTCTCTCTCTCTCTCTATGTTCAAACTAACACATTCTAGCGAGTCTATGACAACCAAACATCTTAT
TCAGCAGTTCAAGATGGCCATCAATGACGCTCTGAAATCGTCGCAGGAGACACGAGCTCTCATGCGTGCACGATC
CGGCAAGCAGCGTTTCCCCGTAGCACAGTGGGTTGAGGATCTGGAAACGCTACAAACCACCTCAATCAAAAAGCA
CGCCAAGTACTCTAAGCGCCACGATCGTGGTTCATGGAGATTTTCCCGTGGCAGCACTCTTGTCCCAGAAAGCAT
CCCTAAAGTCTCGCCGAGCTCAGACAACAGCCGCGAACAGAGCAGATCACGCGGCTCCACCGTATCTGTCCCACC
GAGTAGGCCGATTACGACTGAGATGAGACTGTCTGGACCTCGACCAGGCCTTGACTATGTTCCCTCGCCGACAAC
TCCGTCTTTCAGTCTTAACATGTCCGACAACGAGCCTGATTCTGACGCCGACCCAAGACGCAGACCTTTGTCCTC
CAACCATCTCACAGACTCGCGAGTCGTTTACACCTCGGTAAGCGATGGAGAAGATCTCGAGCCTATTTCCGGGGA
CGGCAATGATCGTCTATCGCCATTTAGGACACCTACCGTTTATTTTGCTCGATCCGGTGCCAGCACACCAGCTCT
CAGTGCAGGATCAGAAGACGGTGTGCTGGGCCGAAGAGATGCAAGGGCGTCTATGATGAGTCTGGTCAGCGTGGA
TGATATAACAAAGGAGAAACAACACTACAATCTCCAGAAAGTTGATCCATTTTTCACGGATGTGAATAACGAGTA
CGCGGAGAAGTTTGAGAAGAAGCTTGCAGGCCTGAATGGCAAGAATTCCGAAGACCAGCTCTGCATCGAGGAGTT
TCTCGAGAAGAGTGAAAAAGACTGGTTCAATCGATACCGCGACGTCAAGCTGGGCAAGTCCCCCTTGCCATCTCC
TGCTCCCTCTGTCTTTCGTTTCAAGGTTCATGAAATCGGTCGCTCAGAGACCCCGCCAATTAATGGTCCAGGTGC
AAGGCCCAATACTGGGCAATTCCTTCTCCCAAATGACTATGTTCCCCCCACGGGTGTGAAGCGTTTCATGTTGAT
GAAGCTGGGTGATTGGCCTGTGTACTCCATCTTCCTCGCTATTGTAAGTTGAAACCCTACCAAAAACCTTCATCA
TAGCCATTGACAGTATTATTCAGGGCCAAATTCTCGCCTTGAATTCGTACCAGATCACACTCCTGAACGGTGAGA
TTGGAGAGACGGCCGAGAAGCTATACATTCTGGCATCCATCTATCTTGCCTCTTCTATCATATGGTGGATGGTCT
TCCGTCTAGTCCCCTCAGTCTACGTGTTGACGATTCCTTTCCTTGTACGTTCAAGTTCCTCTATCCAGCTTACGG
GGTTGCAAGCTAACTAGCCGCAGATATACGGGCTCGCCTTTCTATTTGTCGGTCTTACCGGTCACATCCAAAACG
GCACAAGTCAAACATGGCTACAAAATGTGGGAGTCGGCTTGTATTCGTTTGCGTCTTCGAGTGGTTCGATTTTCT
TCGCCCTCAACTTTGGAGACGAAGGTATGCACCAACTCTTCTAGGAAATATGGAACTTATCTGACTTTCTTGTTC
AGGTGGAGCGCCTCTGAGGTCTTGGATTTACAGGGCCACTGTCATCCAGGGCACCCAGCAATTGTTCATCAGTTT
CCTTTGGTACTGGGGTAGCTGGATGGCAACTCTCAATCAAAAAGGTAGTGAGCAATTCAGCCTTGCCATGACCGA
TCCAGGTGCTTTGCTCGGAATCGGACTCGGACTCGCCTGTTTTATGTGGCTGTTGGGAGCCCTGATCTTCTTTGG
ACTTCCTACATATTACCGACAAGCACCAGGTCAAGTGCCGACATTCTACCTATCGCTCTTCCGTCGTCGCATTAT
TCTTGTATGTCTCTTCCAGTCCCCCCTCAAGCTAATCTTGATTCTGACGCTATATTTTGCAGTGGTTTTTCTACA
TGGTGTTTATATCGAACTACTGGCTGTCGGCACCGTACGGACGGAACTGGCTCTATCTCTGGTCCAGCAAGCATG
CACAGGTGTGGCATATCGTGCTCCTTGTTCTCCTCTTTTTCATCTTTGTCTGGGCGGCAGCTCTCTGGGTCTTTC
ACGTCTTTTCCAAGAGACACGCCTGGTTTATCCCGATCTTTGCTGTCGGTCTTGGTGCTCCTCGATGGGCCCAGA
TCCTGTGGGCGACCTCCAACATAGCCACATACATCCCCTGGGCCGGTGGTCCCGTAGCCGGAGCTATCCTTGGTA
GAGCGCTATGGCTCTGGCTAGGAGTTTTGGATTCCCTTCAGGGTGTCGGTAAGTTCCTTCTCGCGGCGAATAAAA
CGTAACAAAAACTGACTTACGCCAATACAGGGTTTGGAATGATCCTCCTCGTCACAATGACTCGATTCCATGTCA
CCTTCACACTTCTAGCCGCGCAGGTGGTCGGTTCCGTTGCGACTATCCTCGCCCGCGCGACAGCACCGGATAAGT
TAGGCCCTGGTGATGTCTTCCCTGATTTCTCGGCTGGGGTCGCAGCCGGCTTGGAAAAGGCAGACTTCTGGGTGT
GCCTGCTCTTCATGCTGTCCATCAATGTGCTCTGCATCTTCTTCTATCGCAAGGAACAACTTGCGAAACCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail