Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7386.t1
Gene name
Locationscaffold_23:27058..29482
Strand+
Gene length (bp)2424
Transcript length (bp)2310
Coding sequence length (bp)2310
Protein length (aa) 770

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 6.9E-165 70 725

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 72 94 22
2 99 118 19
3 184 206 22
4 256 278 22
5 319 341 22
6 393 415 22
7 445 467 22
8 471 493 22
9 558 580 22
10 624 646 22
11 703 725 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7386.t1
MYSKKLDSDTIKPALVGVDEEVVEGHSDQINLEKDSENTNEEFSYESHRSPFPEVRAVVPETDDPSMPVNTVRMW
LLGIVFTMLGSGINQFFSLRYPSVHIVALVAELLAYPIGVFLAKTLPLTSIRLGPLGTFVVNPDRSFNIKEHALI
VIMSNVSFGYASADATNIIQAASKNFYNFNLKPGFYVLIVLVAQLLGFGVAGLAAPWLVEPARIVWPGVLSNCAM
LETLHSRANSIADGWRITRLRFFMYVMTGAFVWYFFPGLIFTALSYFTWVCWIAPKNVIVNHLFGMQTGLGLSPI
TFDWSQIAYNTNPLLSPSWAALNVFAGFAFFYWIVTPALYYTNTWFTAYLPLMTADVYDNTGAIYDTARVISADN
TLDTVAYQKYSPPYLSATFAFVYGLSFAAITSVLSHIALWHSRDLWAALKGRNKLDIHARLIRASYRRTPWYWYA
GIIVVIMAMSIAMVEVYETKLPVYGVFLALIIPVVYMVPCGIVQGITNVDANQLNVLAEFIGGYMFEGKPLANMI
FKIISTDVVGQGVYFSMDMKLAHYLKVPPRTCFVAQFVATILGALTQAGVTLWMLGNISDICESGQTDGFSCPNG
RTVYSSSVIWGLVGPRRLYSVGKIYSPLLHFFWIGAVAPVVTFLLYRYTRRQFWKYINWPLIFVGTYNVPPATGI
NYSSWALVNFAFNHFIKRRFFAWWTKYNYILAAALDTGLALSGIVIFFCISYPGATFPDWWGNNVYLNTADAQGV
PYKSMPAVGYFGPANGTFS*
Coding >Pro_DTO377G3_2|g7386.t1
ATGTATTCCAAAAAGTTAGATTCCGACACAATCAAACCCGCTCTCGTCGGAGTCGACGAAGAGGTAGTCGAAGGC
CACTCAGACCAAATCAATCTGGAAAAGGACTCCGAGAATACAAATGAAGAGTTCAGCTATGAGTCGCACCGCTCT
CCATTCCCTGAAGTTAGGGCTGTCGTCCCCGAGACGGATGACCCTAGCATGCCAGTCAATACGGTGCGGATGTGG
CTCCTAGGCATTGTTTTCACTATGCTCGGATCTGGTATCAATCAGTTCTTTTCGCTGCGCTATCCGTCGGTTCAT
ATTGTGGCCCTAGTAGCAGAGCTACTTGCCTATCCGATCGGGGTGTTCCTGGCCAAAACTCTTCCTCTCACATCC
ATCCGACTCGGGCCTTTGGGCACATTCGTTGTCAACCCAGACAGGTCGTTTAATATCAAAGAGCACGCGCTTATC
GTGATTATGAGCAATGTGTCCTTCGGGTATGCTTCAGCGGACGCGACAAACATTATCCAGGCTGCCAGCAAGAAC
TTCTACAATTTCAATCTCAAGCCCGGCTTCTACGTGCTCATTGTTCTCGTCGCACAACTTCTTGGGTTTGGCGTC
GCGGGTCTCGCAGCTCCATGGCTCGTCGAGCCGGCTCGCATCGTCTGGCCAGGTGTATTATCCAACTGTGCTATG
CTAGAAACGTTGCATTCGCGAGCGAACTCGATCGCAGATGGATGGCGCATAACCCGTCTCCGATTCTTCATGTAC
GTTATGACCGGTGCCTTTGTCTGGTATTTTTTCCCCGGTCTTATATTCACTGCGTTATCCTATTTCACCTGGGTC
TGCTGGATCGCACCGAAGAACGTCATCGTCAACCATCTCTTCGGCATGCAGACAGGTCTCGGTCTAAGTCCAATT
ACCTTCGACTGGAGCCAGATTGCCTACAACACCAACCCGCTCCTATCACCATCATGGGCTGCGTTGAATGTCTTT
GCTGGCTTCGCGTTCTTCTACTGGATTGTCACACCCGCCCTTTACTACACCAATACCTGGTTCACAGCTTATCTC
CCACTCATGACAGCCGACGTGTACGATAACACGGGCGCCATCTACGACACGGCTCGAGTCATTTCTGCGGATAAT
ACTCTAGATACAGTGGCTTACCAAAAGTACTCGCCTCCATACCTGAGCGCAACGTTTGCCTTTGTATACGGACTT
TCATTTGCTGCCATAACCTCAGTCCTCTCGCACATCGCCCTCTGGCATAGTCGCGACCTGTGGGCTGCTCTCAAA
GGCCGGAATAAGCTCGATATTCATGCTCGGCTCATCCGTGCCTCGTACCGGCGGACCCCGTGGTACTGGTACGCT
GGCATTATCGTGGTTATCATGGCAATGTCCATCGCGATGGTCGAAGTCTATGAGACTAAGCTTCCCGTTTACGGA
GTCTTTCTAGCCTTGATCATCCCGGTTGTATACATGGTTCCCTGCGGTATCGTACAGGGCATTACGAACGTGGAT
GCGAATCAGCTGAATGTTCTGGCCGAGTTCATTGGTGGATATATGTTCGAAGGAAAGCCACTCGCCAATATGATT
TTCAAGATCATTTCCACGGATGTCGTGGGACAGGGTGTTTACTTCTCCATGGATATGAAATTGGCTCATTATCTG
AAAGTGCCGCCACGTACCTGCTTTGTAGCGCAGTTTGTGGCAACTATCCTGGGCGCACTCACACAGGCCGGCGTT
ACACTTTGGATGCTTGGTAATATTTCGGATATTTGCGAATCTGGCCAGACGGATGGGTTTTCCTGTCCAAATGGT
CGGACTGTCTATTCTTCATCTGTTATTTGGGGTCTTGTTGGGCCCCGTCGGCTTTACTCCGTGGGCAAGATCTAT
TCCCCTCTGTTGCACTTCTTCTGGATCGGTGCTGTCGCTCCAGTTGTGACTTTCCTCCTCTACCGTTATACTAGA
CGCCAGTTTTGGAAGTATATTAACTGGCCTCTCATTTTCGTCGGAACTTACAACGTCCCACCTGCGACCGGAATT
AACTATTCCAGCTGGGCACTGGTCAACTTTGCCTTCAATCACTTTATTAAACGCCGATTCTTTGCTTGGTGGACC
AAGTACAATTATATCTTGGCAGCTGCCCTTGATACAGGTCTTGCCCTCAGTGGCATTGTTATTTTCTTTTGCATC
TCGTACCCTGGTGCCACTTTCCCTGACTGGTGGGGGAATAACGTGTACTTGAATACTGCCGACGCCCAGGGTGTA
CCATACAAGTCGATGCCAGCTGTCGGGTATTTTGGGCCTGCTAATGGGACGTTCAGTTGA
Transcript >Pro_DTO377G3_2|g7386.t1
ATGTATTCCAAAAAGTTAGATTCCGACACAATCAAACCCGCTCTCGTCGGAGTCGACGAAGAGGTAGTCGAAGGC
CACTCAGACCAAATCAATCTGGAAAAGGACTCCGAGAATACAAATGAAGAGTTCAGCTATGAGTCGCACCGCTCT
CCATTCCCTGAAGTTAGGGCTGTCGTCCCCGAGACGGATGACCCTAGCATGCCAGTCAATACGGTGCGGATGTGG
CTCCTAGGCATTGTTTTCACTATGCTCGGATCTGGTATCAATCAGTTCTTTTCGCTGCGCTATCCGTCGGTTCAT
ATTGTGGCCCTAGTAGCAGAGCTACTTGCCTATCCGATCGGGGTGTTCCTGGCCAAAACTCTTCCTCTCACATCC
ATCCGACTCGGGCCTTTGGGCACATTCGTTGTCAACCCAGACAGGTCGTTTAATATCAAAGAGCACGCGCTTATC
GTGATTATGAGCAATGTGTCCTTCGGGTATGCTTCAGCGGACGCGACAAACATTATCCAGGCTGCCAGCAAGAAC
TTCTACAATTTCAATCTCAAGCCCGGCTTCTACGTGCTCATTGTTCTCGTCGCACAACTTCTTGGGTTTGGCGTC
GCGGGTCTCGCAGCTCCATGGCTCGTCGAGCCGGCTCGCATCGTCTGGCCAGGTGTATTATCCAACTGTGCTATG
CTAGAAACGTTGCATTCGCGAGCGAACTCGATCGCAGATGGATGGCGCATAACCCGTCTCCGATTCTTCATGTAC
GTTATGACCGGTGCCTTTGTCTGGTATTTTTTCCCCGGTCTTATATTCACTGCGTTATCCTATTTCACCTGGGTC
TGCTGGATCGCACCGAAGAACGTCATCGTCAACCATCTCTTCGGCATGCAGACAGGTCTCGGTCTAAGTCCAATT
ACCTTCGACTGGAGCCAGATTGCCTACAACACCAACCCGCTCCTATCACCATCATGGGCTGCGTTGAATGTCTTT
GCTGGCTTCGCGTTCTTCTACTGGATTGTCACACCCGCCCTTTACTACACCAATACCTGGTTCACAGCTTATCTC
CCACTCATGACAGCCGACGTGTACGATAACACGGGCGCCATCTACGACACGGCTCGAGTCATTTCTGCGGATAAT
ACTCTAGATACAGTGGCTTACCAAAAGTACTCGCCTCCATACCTGAGCGCAACGTTTGCCTTTGTATACGGACTT
TCATTTGCTGCCATAACCTCAGTCCTCTCGCACATCGCCCTCTGGCATAGTCGCGACCTGTGGGCTGCTCTCAAA
GGCCGGAATAAGCTCGATATTCATGCTCGGCTCATCCGTGCCTCGTACCGGCGGACCCCGTGGTACTGGTACGCT
GGCATTATCGTGGTTATCATGGCAATGTCCATCGCGATGGTCGAAGTCTATGAGACTAAGCTTCCCGTTTACGGA
GTCTTTCTAGCCTTGATCATCCCGGTTGTATACATGGTTCCCTGCGGTATCGTACAGGGCATTACGAACGTGGAT
GCGAATCAGCTGAATGTTCTGGCCGAGTTCATTGGTGGATATATGTTCGAAGGAAAGCCACTCGCCAATATGATT
TTCAAGATCATTTCCACGGATGTCGTGGGACAGGGTGTTTACTTCTCCATGGATATGAAATTGGCTCATTATCTG
AAAGTGCCGCCACGTACCTGCTTTGTAGCGCAGTTTGTGGCAACTATCCTGGGCGCACTCACACAGGCCGGCGTT
ACACTTTGGATGCTTGGTAATATTTCGGATATTTGCGAATCTGGCCAGACGGATGGGTTTTCCTGTCCAAATGGT
CGGACTGTCTATTCTTCATCTGTTATTTGGGGTCTTGTTGGGCCCCGTCGGCTTTACTCCGTGGGCAAGATCTAT
TCCCCTCTGTTGCACTTCTTCTGGATCGGTGCTGTCGCTCCAGTTGTGACTTTCCTCCTCTACCGTTATACTAGA
CGCCAGTTTTGGAAGTATATTAACTGGCCTCTCATTTTCGTCGGAACTTACAACGTCCCACCTGCGACCGGAATT
AACTATTCCAGCTGGGCACTGGTCAACTTTGCCTTCAATCACTTTATTAAACGCCGATTCTTTGCTTGGTGGACC
AAGTACAATTATATCTTGGCAGCTGCCCTTGATACAGGTCTTGCCCTCAGTGGCATTGTTATTTTCTTTTGCATC
TCGTACCCTGGTGCCACTTTCCCTGACTGGTGGGGGAATAACGTGTACTTGAATACTGCCGACGCCCAGGGTGTA
CCATACAAGTCGATGCCAGCTGTCGGGTATTTTGGGCCTGCTAATGGGACGTTCAGTTGA
Gene >Pro_DTO377G3_2|g7386.t1
ATGTATTCCAAAAAGTTAGATTCCGACACAATCAAACCCGCTCTCGTCGGAGTCGACGAAGAGGTAGTCGAAGGC
CACTCAGACCAAATCAATCTGGAAAAGGACTCCGAGAATACAAATGAAGAGTTCAGCTATGAGTCGCACCGCTCT
CCATTCCCTGAAGGTGAGTACCCAGCTCACTGTTGATATATATGTCGATTGACTAACAGTGACCACAGTTAGGGC
TGTCGTCCCCGAGACGGATGACCCTAGCATGCCAGTCAATACGGTGCGGATGTGGCTCCTAGGCATTGTTTTCAC
TATGCTCGGATCTGGTATCAATCAGTTCTTTTCGCTGCGCTATCCGTCGGTTCATATTGTGGCCCTAGTAGCAGA
GCTACTTGCCTATCCGATCGGGGTGTTCCTGGCCAAAACTCTTCCTCTCACATCCATCCGACTCGGGCCTTTGGG
CACATTCGTTGTCAACCCAGACAGGTCGTTTAATATCAAAGAGCACGCGCTTATCGTGATTATGAGCAATGTGTC
CTTCGGGTATGCTTCAGCGGACGCGACAAACATTATCCAGGCTGCCAGCAAGAACTTCTACAATTTCAATCTCAA
GCCCGGCTTCTACGTGCTCATTGTTCTCGTCGCACAACTTCTTGGGTTTGGCGTCGCGGGTCTCGCAGCTCCATG
GCTCGTCGAGCCGGCTCGCATCGTCTGGCCAGGTGTATTATCCAACTGTGCTATGCTAGAAACGTTGCATTCGCG
AGCGAACTCGATCGCAGATGGATGGCGCATAACCCGTCTCCGATTCTTCATGTACGTTATGACCGGTGCCTTTGT
CTGGTATTTTTTCCCCGGTCTTATATTCACTGCGTTATCCTATTTCACCTGGGTCTGCTGGATCGCACCGAAGAA
CGTCATCGTCAACCATCTCTTCGGCATGCAGACAGGTCTCGGTCTAAGTCCAATTACCTTCGACTGGAGCCAGAT
TGCCTACAACACCAACCCGCTCCTATCACCATCATGGGCTGCGTTGAATGTCTTTGCTGGCTTCGCGTTCTTCTA
CTGGATTGTCACACCCGCCCTTTACTACACCAATACCTGGTTCACAGCTTATCTCCCACTCATGACAGCCGACGT
GTACGATAACACGGGCGCCATCTACGACACGGCTCGAGTCATTTCTGCGGATAATACTCTAGATACAGTGGCTTA
CCAAAAGTACTCGCCTCCATACCTGAGCGCAACGTTTGCCTTTGTATACGGACTTTCATTTGCTGCCATAACCTC
AGTCCTCTCGCACATCGCCCTCTGGCATAGTCGCGACCTGTGGGCTGCTCTCAAAGGCCGGAATAAGCTCGATAT
TCATGCTCGGCTCATCCGTGCCTCGTACCGGCGGACCCCGTGGTACTGGTACGCTGGCATTATCGTGGTTATCAT
GGCAATGTCCATCGCGATGGTCGAAGTCTATGAGACTAAGCTTCCCGTTTACGGAGTCTTTCTAGCCTTGATCAT
CCCGGTTGTATACATGGTTCCCTGCGGTATCGTACAGGGCATTACGAACGTGGATGCGAATCAGCTGAATGTTCT
GGCCGAGTTCATTGGTGGATATATGTTCGAAGGAAAGCCACTCGCCAATATGATTTTCAAGATCATTTCCACGGA
TGTCGTGGGACAGGGTGTTTACTTCTCCATGGATATGAAATTGGCTCATTATCTGAAAGTGCCGCCACGTACCTG
CTTTGTAGCGCAGTTTGTGGCAACTATCCTGGGCGCACTCACACAGGCCGGCGTTACACTTTGGATGCTTGGTAA
TATTTCGGATATTTGCGAATCTGGCCAGACGGATGGGTTTTCCTGTCCAAATGGTCGGACTGTCTATTCTTCATC
TGTTATTTGGGGTCTTGTTGGGCCCCGTCGGCTTTACTCCGTGGGCAAGATCTATTCCCCTCTGTTGCACTTCTT
CTGGATCGGTGCTGTCGCTCCAGTTGTGACTTTCCTCCTCTACCGTTATACTAGACGCCAGTTTTGGAAGTATAT
TAACTGGCCTCTCATTTTCGTCGGAACTTACAACGTCCCACCTGGTATGTCCCGCAACTTGCCAGTGCCTCTTTA
TTTCAAAAGCTAACTAAATGCTTTTTAGCGACCGGAATTAACTATTCCAGCTGGGCACTGGTCAACTTTGCCTTC
AATCACTTTATTAAACGCCGATTCTTTGCTTGGTGGACCAAGTACAATTATATCTTGGCAGCTGCCCTTGATACA
GGTCTTGCCCTCAGTGGCATTGTTATTTTCTTTTGCATCTCGTACCCTGGTGCCACTTTCCCTGACTGGTGGGGG
AATAACGTGTACTTGAATACTGCCGACGCCCAGGGTGTACCATACAAGTCGATGCCAGCTGTCGGGTATTTTGGG
CCTGCTAATGGGACGTTCAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail