Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7380.t1
Gene name
Locationscaffold_22:388992..391159
Strand-
Gene length (bp)2167
Transcript length (bp)2061
Coding sequence length (bp)2061
Protein length (aa) 687

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04433 SWIRM SWIRM domain 4.5E-32 140 225
PF16495 SWIRM-assoc_1 SWIRM-associated region 1 2.8E-30 547 629
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 3.1E-08 403 445
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 9.8E-06 404 445

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 50.77 31.08 70.47
5d_25C Five days - 25 degrees Celsius 53.30 32.62 73.98
7d_25C Seven days - 25 degrees Celsius 63.96 39.28 88.65
10d_25C Ten days - 25 degrees Celsius 76.35 46.53 106.18
7d_15C Seven days - 15 degrees Celsius 58.44 35.62 81.25
7d_30C Seven days - 30 degrees Celsius 54.16 33.16 75.17

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.880984 no
3d_25C 7d_25C 0.319837 no
3d_25C 7d_15C 0.599373 no
3d_25C 7d_30C 0.832664 no
3d_25C 10d_25C 0.050334 no
5d_25C 7d_25C 0.460706 no
5d_25C 7d_15C 0.753043 no
5d_25C 7d_30C 0.961967 no
5d_25C 10d_25C 0.088027 no
7d_25C 7d_15C 0.752749 no
7d_25C 7d_30C 0.507323 no
7d_25C 10d_25C 0.481507 no
7d_15C 7d_30C 0.800975 no
7d_15C 10d_25C 0.250815 no
7d_30C 10d_25C 0.110283 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7380.t1
MDDTHINQAAAHENVQSMTGLDGAADAARGASGAQSRQNSPVKKIENTPGSDNPMYAPASPKPRHGGVEPEDEEM
GGTETDAKPDTEGLEDAAGESHTQGEGTDGLEDAVGEEQPAPSKSSLEAAAREQLVTQTHAIILPSYATWFDMNT
INPIEKKALAEFFNGRNRSKTPATYKDYRDFMINTYRLNPIEYLTVTACRRNLAGDVCAIMRVHSFLEQWGLINY
QVDPQTRPSNIGPPFTGHFRVVADTPRGLQPFQPGPNHSVTSGKFHPGTQRAVSSIPASKDDLNLELRRTIYDEK
GKDITSAKDKEKQINGEATNGLDIARESKKKAHCFSCGIDCTKLRFHYAKSASTSANAATPDTKYDLCPNCFLQA
RMPSSHNASDFVKLEDKTYSHFTDKNTPWSDSEVILLLEGLENFDENWEQIASHVGTRSREECVMKFLQLEIEDK
YVEDVPEPQLGSGRDPISQSENPVLSVVAFLAQMVEPAVAAAAAGRSVDEIRKELRSQLEKGHDKGKDAVKSEDS
MDVDPAREAEQQSAKPKETLGTIALAASAARAGALASHEEREMTRLVSAAVNVTLQKFEIKLQQFNEMEEIIEAE
RRELEQARQQLFLDRMTFKKRVKEAQDALQTVSLQGPNEHTHQMLADAATTGIGHHYSFQPVGGDMRAGTQPLSA
QGGADYKTLDL*
Coding >Pro_DTO377G3_2|g7380.t1
ATGGATGACACTCACATCAACCAAGCTGCGGCCCACGAGAATGTCCAGTCTATGACTGGCCTAGATGGCGCAGCT
GATGCAGCTCGCGGAGCCTCTGGAGCGCAATCGCGCCAGAATTCGCCCGTGAAGAAGATTGAGAATACACCTGGG
TCCGACAATCCGATGTACGCCCCAGCATCTCCCAAACCTCGCCACGGCGGGGTTGAACCGGAAGACGAAGAGATG
GGTGGTACTGAGACCGATGCCAAGCCCGACACCGAAGGCTTGGAGGATGCTGCGGGCGAGTCGCATACGCAAGGA
GAGGGAACAGATGGGCTTGAAGATGCTGTGGGTGAAGAACAACCCGCACCATCCAAGTCGTCTCTGGAAGCCGCC
GCGCGCGAACAACTCGTCACGCAAACACACGCCATCATTCTCCCCAGCTATGCGACCTGGTTTGATATGAACACC
ATTAACCCAATCGAGAAGAAAGCTCTCGCCGAATTCTTTAATGGCCGCAACCGCAGTAAGACGCCTGCTACATAC
AAAGATTACCGGGACTTCATGATCAATACCTATCGATTGAACCCCATCGAGTATTTGACTGTTACTGCTTGCCGT
CGCAACCTTGCCGGTGACGTCTGTGCTATTATGCGTGTTCACTCATTCCTTGAGCAGTGGGGCTTGATCAACTAC
CAGGTTGACCCTCAGACACGTCCGTCCAATATTGGCCCGCCATTCACCGGTCACTTCCGAGTTGTCGCAGATACT
CCACGGGGTCTGCAGCCATTCCAGCCTGGGCCAAACCACAGCGTCACGTCCGGCAAGTTTCATCCAGGCACACAG
CGTGCTGTCTCTTCCATCCCTGCATCCAAAGACGACCTCAACCTCGAACTCCGCCGCACCATTTACGATGAAAAA
GGCAAGGATATCACCTCCGCCAAAGATAAAGAGAAACAGATCAACGGCGAAGCAACAAACGGCTTGGACATTGCT
CGGGAATCCAAGAAGAAGGCACACTGCTTCTCTTGTGGTATTGATTGCACTAAACTTCGATTCCACTACGCTAAA
TCGGCTTCGACATCAGCCAATGCCGCTACGCCAGACACCAAGTATGATCTGTGTCCCAACTGTTTCCTTCAAGCG
CGAATGCCTTCTAGCCACAATGCCTCGGACTTCGTTAAGCTCGAGGACAAGACCTACTCTCACTTCACTGACAAA
AACACTCCATGGTCAGACTCAGAAGTGATTTTGTTGCTGGAAGGCCTGGAAAACTTCGATGAAAACTGGGAACAG
ATTGCGAGCCACGTTGGCACACGATCTCGGGAAGAGTGTGTCATGAAGTTCCTACAGCTAGAGATCGAGGACAAA
TACGTTGAAGATGTCCCAGAGCCGCAGTTGGGCAGCGGACGCGACCCCATCAGCCAGTCAGAAAACCCTGTTCTT
TCTGTTGTGGCTTTCCTGGCCCAGATGGTGGAGCCCGCAGTAGCTGCCGCTGCCGCCGGTCGGTCCGTCGACGAG
ATCCGCAAGGAGCTCCGGAGCCAGCTGGAGAAGGGGCATGACAAAGGCAAAGATGCAGTCAAGTCCGAAGATTCT
ATGGACGTAGATCCCGCACGTGAGGCCGAGCAGCAATCCGCGAAGCCTAAGGAGACTCTCGGCACCATCGCCCTG
GCCGCATCTGCCGCGCGTGCCGGAGCTCTTGCCTCGCACGAGGAGCGTGAAATGACCCGCCTAGTCTCTGCTGCA
GTCAACGTCACCTTGCAGAAGTTTGAGATCAAGCTGCAGCAATTCAATGAGATGGAAGAGATTATCGAGGCTGAG
CGTCGTGAGTTGGAGCAGGCGCGTCAGCAACTCTTCTTGGACCGGATGACATTCAAGAAGCGTGTTAAGGAGGCC
CAGGATGCGCTCCAGACTGTCAGCCTGCAGGGCCCCAACGAACACACGCATCAGATGCTAGCCGATGCTGCTACT
ACAGGTATTGGACACCACTACAGCTTCCAGCCTGTTGGCGGAGATATGCGGGCTGGAACCCAGCCTCTAAGCGCC
CAAGGTGGTGCTGACTACAAGACCCTTGACCTGTAG
Transcript >Pro_DTO377G3_2|g7380.t1
ATGGATGACACTCACATCAACCAAGCTGCGGCCCACGAGAATGTCCAGTCTATGACTGGCCTAGATGGCGCAGCT
GATGCAGCTCGCGGAGCCTCTGGAGCGCAATCGCGCCAGAATTCGCCCGTGAAGAAGATTGAGAATACACCTGGG
TCCGACAATCCGATGTACGCCCCAGCATCTCCCAAACCTCGCCACGGCGGGGTTGAACCGGAAGACGAAGAGATG
GGTGGTACTGAGACCGATGCCAAGCCCGACACCGAAGGCTTGGAGGATGCTGCGGGCGAGTCGCATACGCAAGGA
GAGGGAACAGATGGGCTTGAAGATGCTGTGGGTGAAGAACAACCCGCACCATCCAAGTCGTCTCTGGAAGCCGCC
GCGCGCGAACAACTCGTCACGCAAACACACGCCATCATTCTCCCCAGCTATGCGACCTGGTTTGATATGAACACC
ATTAACCCAATCGAGAAGAAAGCTCTCGCCGAATTCTTTAATGGCCGCAACCGCAGTAAGACGCCTGCTACATAC
AAAGATTACCGGGACTTCATGATCAATACCTATCGATTGAACCCCATCGAGTATTTGACTGTTACTGCTTGCCGT
CGCAACCTTGCCGGTGACGTCTGTGCTATTATGCGTGTTCACTCATTCCTTGAGCAGTGGGGCTTGATCAACTAC
CAGGTTGACCCTCAGACACGTCCGTCCAATATTGGCCCGCCATTCACCGGTCACTTCCGAGTTGTCGCAGATACT
CCACGGGGTCTGCAGCCATTCCAGCCTGGGCCAAACCACAGCGTCACGTCCGGCAAGTTTCATCCAGGCACACAG
CGTGCTGTCTCTTCCATCCCTGCATCCAAAGACGACCTCAACCTCGAACTCCGCCGCACCATTTACGATGAAAAA
GGCAAGGATATCACCTCCGCCAAAGATAAAGAGAAACAGATCAACGGCGAAGCAACAAACGGCTTGGACATTGCT
CGGGAATCCAAGAAGAAGGCACACTGCTTCTCTTGTGGTATTGATTGCACTAAACTTCGATTCCACTACGCTAAA
TCGGCTTCGACATCAGCCAATGCCGCTACGCCAGACACCAAGTATGATCTGTGTCCCAACTGTTTCCTTCAAGCG
CGAATGCCTTCTAGCCACAATGCCTCGGACTTCGTTAAGCTCGAGGACAAGACCTACTCTCACTTCACTGACAAA
AACACTCCATGGTCAGACTCAGAAGTGATTTTGTTGCTGGAAGGCCTGGAAAACTTCGATGAAAACTGGGAACAG
ATTGCGAGCCACGTTGGCACACGATCTCGGGAAGAGTGTGTCATGAAGTTCCTACAGCTAGAGATCGAGGACAAA
TACGTTGAAGATGTCCCAGAGCCGCAGTTGGGCAGCGGACGCGACCCCATCAGCCAGTCAGAAAACCCTGTTCTT
TCTGTTGTGGCTTTCCTGGCCCAGATGGTGGAGCCCGCAGTAGCTGCCGCTGCCGCCGGTCGGTCCGTCGACGAG
ATCCGCAAGGAGCTCCGGAGCCAGCTGGAGAAGGGGCATGACAAAGGCAAAGATGCAGTCAAGTCCGAAGATTCT
ATGGACGTAGATCCCGCACGTGAGGCCGAGCAGCAATCCGCGAAGCCTAAGGAGACTCTCGGCACCATCGCCCTG
GCCGCATCTGCCGCGCGTGCCGGAGCTCTTGCCTCGCACGAGGAGCGTGAAATGACCCGCCTAGTCTCTGCTGCA
GTCAACGTCACCTTGCAGAAGTTTGAGATCAAGCTGCAGCAATTCAATGAGATGGAAGAGATTATCGAGGCTGAG
CGTCGTGAGTTGGAGCAGGCGCGTCAGCAACTCTTCTTGGACCGGATGACATTCAAGAAGCGTGTTAAGGAGGCC
CAGGATGCGCTCCAGACTGTCAGCCTGCAGGGCCCCAACGAACACACGCATCAGATGCTAGCCGATGCTGCTACT
ACAGGTATTGGACACCACTACAGCTTCCAGCCTGTTGGCGGAGATATGCGGGCTGGAACCCAGCCTCTAAGCGCC
CAAGGTGGTGCTGACTACAAGACCCTTGACCTGTAG
Gene >Pro_DTO377G3_2|g7380.t1
ATGGATGACACTCACATCAACCAAGCTGCGGCCCACGAGAATGTCCAGTCTATGACTGGCCTAGATGGCGCAGCT
GATGCAGCTCGCGGAGCCTCTGGTATGCCTACTCTCAAATGGCTTTTATGTTGCACCGAGTGCTAAATTTGTGGA
CAGGAGCGCAATCGCGCCAGAATTCGCCCGTGAAGAAGATTGAGAATACACCTGGGTCCGACAATCCGATGTACG
CCCCAGCATCTCCCAAACCTCGCCACGGCGGGGTTGAACCGGAAGACGAAGAGATGGGTGGTACTGAGACCGATG
CCAAGCCCGACACCGAAGGCTTGGAGGATGCTGCGGGCGAGTCGCATACGCAAGGAGAGGGAACAGATGGGCTTG
AAGATGCTGTGGGTGAAGAACAACCCGCACCATCCAAGTCGTCTCTGGAAGCCGCCGCGCGCGAACAACTCGTCA
CGCAAACACACGCCATCATTCTCCCCAGCTATGCGACCTGGTTTGATATGAACACCATTAACCCAATCGAGAAGA
AAGCTCTCGCCGAATTCTTTAATGGCCGCAACCGCAGTAAGACGCCTGCTACATACAAAGATTACCGGGACTTCA
TGATCAATACCTATCGATTGAACCCCATCGAGTATTTGACTGTTACTGCTTGCCGTCGCAACCTTGCCGGTGACG
TCTGTGCTATTATGCGTGTTCACTCATTCCTTGAGCAGTGGGGCTTGATCAACTACCAGGTGAATGACCGTGTTT
TCCCATTCAAGCATCTTATCTAACATCTCTGCAGGTTGACCCTCAGACACGTCCGTCCAATATTGGCCCGCCATT
CACCGGTCACTTCCGAGTTGTCGCAGATACTCCACGGGGTCTGCAGCCATTCCAGCCTGGGCCAAACCACAGCGT
CACGTCCGGCAAGTTTCATCCAGGCACACAGCGTGCTGTCTCTTCCATCCCTGCATCCAAAGACGACCTCAACCT
CGAACTCCGCCGCACCATTTACGATGAAAAAGGCAAGGATATCACCTCCGCCAAAGATAAAGAGAAACAGATCAA
CGGCGAAGCAACAAACGGCTTGGACATTGCTCGGGAATCCAAGAAGAAGGCACACTGCTTCTCTTGTGGTATTGA
TTGCACTAAACTTCGATTCCACTACGCTAAATCGGCTTCGACATCAGCCAATGCCGCTACGCCAGACACCAAGTA
TGATCTGTGTCCCAACTGTTTCCTTCAAGCGCGAATGCCTTCTAGCCACAATGCCTCGGACTTCGTTAAGCTCGA
GGACAAGACCTACTCTCACTTCACTGACAAAAACACTCCATGGTCAGACTCAGAAGTGATTTTGTTGCTGGAAGG
CCTGGAAAACTTCGATGAAAACTGGGAACAGATTGCGAGCCACGTTGGCACACGATCTCGGGAAGAGTGTGTCAT
GAAGTTCCTACAGCTAGAGATCGAGGACAAATACGTTGAAGATGTCCCAGAGCCGCAGTTGGGCAGCGGACGCGA
CCCCATCAGCCAGTCAGAAAACCCTGTTCTTTCTGTTGTGGCTTTCCTGGCCCAGATGGTGGAGCCCGCAGTAGC
TGCCGCTGCCGCCGGTCGGTCCGTCGACGAGATCCGCAAGGAGCTCCGGAGCCAGCTGGAGAAGGGGCATGACAA
AGGCAAAGATGCAGTCAAGTCCGAAGATTCTATGGACGTAGATCCCGCACGTGAGGCCGAGCAGCAATCCGCGAA
GCCTAAGGAGACTCTCGGCACCATCGCCCTGGCCGCATCTGCCGCGCGTGCCGGAGCTCTTGCCTCGCACGAGGA
GCGTGAAATGACCCGCCTAGTCTCTGCTGCAGTCAACGTCACCTTGCAGAAGTTTGAGATCAAGCTGCAGCAATT
CAATGAGATGGAAGAGATTATCGAGGCTGAGCGTCGTGAGTTGGAGCAGGCGCGTCAGCAACTCTTCTTGGACCG
GATGACATTCAAGAAGCGTGTTAAGGAGGCCCAGGATGCGCTCCAGACTGTCAGCCTGCAGGGCCCCAACGAACA
CACGCATCAGATGCTAGCCGATGCTGCTACTACAGGTATTGGACACCACTACAGCTTCCAGCCTGTTGGCGGAGA
TATGCGGGCTGGAACCCAGCCTCTAAGCGCCCAAGGTGGTGCTGACTACAAGACCCTTGACCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail