Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g738.t1
Gene name
Locationscaffold_01:1893655..1894597
Strand+
Gene length (bp)942
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11309 DUF3112 Protein of unknown function (DUF3112) 1.1E-06 208 273

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 54 76 22
3 86 108 22
4 131 153 22
5 168 190 22
6 202 224 22
7 244 266 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g738.t1
MGGPYMPRTASMGGRPTIPLDVPICAVFLALFIIGAACHMTLFRRNLARDHKFIPSGATFGFCMSRIIANILRIA
WACHPTNIRLAIAAQIFVAAGVLLLFILNLLYAQRMFRAVYPVLGWSRPVSWAFKALYALVVVTIIMVITCVIQS
SYTLNSNTLRIDRDIQLYGQTYFAIISFLPLPLVALVLLSPNRKYIEQVGYGSWIAKVFIVGLVGSLLCLGASFR
AGTSWMPPRPVTDPAWYHSRACFYIFNFTIDILVVAIFFVVRVDRRFWVPNGSSEVRHYRRGENNAQVAQEGTAL
TVHDKQDIETQSR*
Coding >Pro_DTO377G3_2|g738.t1
ATGGGAGGACCCTATATGCCTCGAACGGCCTCCATGGGAGGTCGACCAACAATTCCCCTCGATGTCCCAATATGC
GCCGTCTTCCTCGCTCTTTTCATCATCGGCGCCGCCTGCCATATGACCCTGTTCCGTCGCAACCTCGCAAGGGAC
CACAAATTCATTCCATCGGGCGCAACATTCGGTTTCTGCATGTCGCGTATTATCGCAAACATCCTTCGCATCGCC
TGGGCCTGTCACCCGACGAACATTAGACTTGCGATTGCAGCACAGATCTTCGTTGCTGCCGGCGTGTTGCTGCTT
TTCATCTTGAACTTGCTATACGCACAGCGTATGTTCCGAGCCGTCTACCCAGTCCTCGGATGGTCCCGACCAGTA
TCTTGGGCGTTCAAAGCACTGTATGCTCTCGTCGTAGTAACGATCATCATGGTCATCACTTGTGTTATTCAGAGT
TCGTATACTCTCAACTCGAACACCCTTCGTATCGATCGTGATATCCAGCTCTATGGCCAGACATACTTCGCCATC
ATCTCGTTCCTACCGCTTCCGCTTGTCGCACTTGTCCTTCTGTCTCCGAATAGAAAGTATATTGAACAGGTTGGC
TATGGTAGCTGGATCGCCAAAGTCTTCATCGTCGGACTTGTCGGCTCATTGCTCTGCCTTGGAGCATCATTTCGT
GCCGGGACCTCTTGGATGCCACCTCGTCCTGTCACGGACCCAGCCTGGTATCACAGTAGGGCCTGCTTCTATATC
TTTAACTTCACTATTGATATTCTAGTCGTGGCCATTTTCTTCGTCGTTCGTGTTGACCGGCGATTCTGGGTTCCA
AATGGGAGCTCGGAAGTGCGTCACTACAGACGTGGTGAGAATAACGCGCAAGTCGCACAAGAGGGGACTGCTCTT
ACGGTTCACGACAAACAGGATATCGAGACGCAGAGTAGGTAG
Transcript >Pro_DTO377G3_2|g738.t1
ATGGGAGGACCCTATATGCCTCGAACGGCCTCCATGGGAGGTCGACCAACAATTCCCCTCGATGTCCCAATATGC
GCCGTCTTCCTCGCTCTTTTCATCATCGGCGCCGCCTGCCATATGACCCTGTTCCGTCGCAACCTCGCAAGGGAC
CACAAATTCATTCCATCGGGCGCAACATTCGGTTTCTGCATGTCGCGTATTATCGCAAACATCCTTCGCATCGCC
TGGGCCTGTCACCCGACGAACATTAGACTTGCGATTGCAGCACAGATCTTCGTTGCTGCCGGCGTGTTGCTGCTT
TTCATCTTGAACTTGCTATACGCACAGCGTATGTTCCGAGCCGTCTACCCAGTCCTCGGATGGTCCCGACCAGTA
TCTTGGGCGTTCAAAGCACTGTATGCTCTCGTCGTAGTAACGATCATCATGGTCATCACTTGTGTTATTCAGAGT
TCGTATACTCTCAACTCGAACACCCTTCGTATCGATCGTGATATCCAGCTCTATGGCCAGACATACTTCGCCATC
ATCTCGTTCCTACCGCTTCCGCTTGTCGCACTTGTCCTTCTGTCTCCGAATAGAAAGTATATTGAACAGGTTGGC
TATGGTAGCTGGATCGCCAAAGTCTTCATCGTCGGACTTGTCGGCTCATTGCTCTGCCTTGGAGCATCATTTCGT
GCCGGGACCTCTTGGATGCCACCTCGTCCTGTCACGGACCCAGCCTGGTATCACAGTAGGGCCTGCTTCTATATC
TTTAACTTCACTATTGATATTCTAGTCGTGGCCATTTTCTTCGTCGTTCGTGTTGACCGGCGATTCTGGGTTCCA
AATGGGAGCTCGGAAGTGCGTCACTACAGACGTGGTGAGAATAACGCGCAAGTCGCACAAGAGGGGACTGCTCTT
ACGGTTCACGACAAACAGGATATCGAGACGCAGAGTAGGTAG
Gene >Pro_DTO377G3_2|g738.t1
ATGGGAGGACCCTATATGCCTCGAACGGCCTCCATGGGAGGTCGACCAACAATTCCCCTCGATGTCCCAATATGC
GCCGTCTTCCTCGCTCTTTTCATCATCGGCGCCGCCTGCCATATGACCCTGTTCCGTCGCAACCTCGCAAGGGAC
CACAAATTCATTCCATCGGGCGCAACATTCGGTTTCTGCATGTCGCGTATTATCGCAAACATCCTTCGCATCGCC
TGGGCCTGTCACCCGACGAACATTAGACTTGCGATTGCAGCACAGATCTTCGTTGCTGCCGGCGTGTTGCTGCTT
TTCATCTTGAACTTGCTATACGCACAGCGTATGTTCCGAGCCGTCTACCCAGTCCTCGGATGGTCCCGACCAGTA
TCTTGGGCGTTCAAAGCACTGTATGCTCTCGTCGTAGTAACGATCATCATGGTCATCACTTGTGTTATTCAGAGT
TCGTATACTCTCAACTCGAACACCCTTCGTATCGATCGTGATATCCAGCTCTATGGCCAGACATACTTCGCCATC
ATCTCGTTCCTACCGCTTCCGCTTGTCGCACTTGTCCTTCTGTCTCCGAATAGAAAGTATATTGAACAGGTTGGC
TATGGTAGCTGGATCGCCAAAGTCTTCATCGTCGGACTTGTCGGCTCATTGCTCTGCCTTGGAGCATCATTTCGT
GCCGGGACCTCTTGGATGCCACCTCGTCCTGTCACGGACCCAGCCTGGTATCACAGTAGGGCCTGCTTCTATATC
TTTAACTTCACTATTGATATTCTAGTCGTGGCCATTTTCTTCGTCGTTCGTGTTGACCGGCGATTCTGGGTTCCA
AATGGGAGCTCGGAAGTGCGTCACTACAGACGTGGTGAGAATAACGCGCAAGTCGCACAAGAGGGGACTGCTCTT
ACGGTTCACGACAAACAGGATATCGAGACGCAGAGTAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail