Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7379.t1
Gene name
Locationscaffold_22:386344..388155
Strand-
Gene length (bp)1811
Transcript length (bp)1683
Coding sequence length (bp)1683
Protein length (aa) 561

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 4.5E-24 118 256
PF08031 BBE Berberine and berberine like 1.6E-12 500 543

GO

GO Term Description Terminal node
GO:0055114 oxidation-reduction process Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0008152 metabolic process No
GO:0048037 cofactor binding No
GO:0050662 coenzyme binding No
GO:0003824 catalytic activity No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7379.t1
MFFRASLIASLLAVLPQASASACRCFPGDACWPTEDQWSQLNKTVDGRLVKTVPLGTPCHAPNYNSETCAVLKDG
WLLPEEHYESSSSVMAPFFAEGACDPFHPVSKPCTLGNYVRYSVNVTSPAHISNAVKFATKHNIRLVIRNTGHDY
NGRSTGAGALAIWTHHLKDLSIDSYHDKHYTGKAITMGAGIQGHEAYEIAEETGYQVVGGECPTVGLAGGYTQGG
GHSALGSRYGLAADQVLKWEVIDGQGNCITATRDNEHSDIFWALSGGGAGTYGIVWSMTSKAHPGTPVSGLNLTY
TNDGISQDTFFNTIETFHAALPAIVDAGAMSVWYFTNTSFSIAPITGPNIPVADLVTLLKPFTNSLDKLGIEYTM
VSKQYDSYYSQFKDMQGTIEVGTAQYGGWLVPRSVVQNNNHALLTAYREITEAGGTFIGVGLNVSHKVSGDVHNA
VLPAWREALIDTTLTTPWEWDNSALMLERQRQMTEDFIPKLTALSPKSGAYMNEGDFQQPNFKKVFYGTNYDTLR
KVKAKYDPNNIFYARTAVGSDEWTESKDGRLCKAT*
Coding >Pro_DTO377G3_2|g7379.t1
ATGTTTTTCCGCGCATCCCTCATTGCTTCGCTGTTGGCAGTTCTGCCTCAGGCTTCAGCCTCGGCATGCCGTTGC
TTTCCCGGTGATGCTTGCTGGCCCACCGAGGATCAATGGTCCCAATTGAACAAAACCGTCGATGGTCGACTAGTC
AAGACCGTCCCTCTCGGCACACCTTGCCATGCGCCGAACTACAATTCCGAGACCTGTGCAGTCTTGAAGGATGGG
TGGCTACTTCCTGAGGAGCACTATGAATCATCTTCCTCGGTTATGGCGCCGTTCTTTGCCGAGGGTGCTTGCGAT
CCGTTCCACCCCGTCTCAAAGCCCTGCACCCTGGGTAACTATGTGCGCTACAGCGTGAATGTCACCAGCCCGGCT
CACATTTCCAACGCTGTGAAATTCGCAACGAAGCACAACATCCGTCTTGTCATCCGTAACACCGGCCACGACTAC
AATGGCCGATCCACTGGCGCTGGAGCGCTTGCAATCTGGACTCACCACCTGAAGGATCTGTCAATCGACTCCTAC
CATGACAAGCACTACACCGGAAAGGCCATTACCATGGGCGCTGGAATCCAAGGCCACGAAGCCTACGAGATCGCC
GAGGAAACTGGTTACCAGGTCGTCGGCGGCGAATGTCCCACCGTTGGTCTTGCCGGTGGCTACACCCAAGGAGGC
GGTCACTCCGCACTGGGCTCCCGCTATGGCCTGGCCGCCGATCAAGTCCTGAAATGGGAGGTCATTGACGGCCAA
GGCAACTGCATCACGGCTACCCGCGACAATGAGCACTCTGACATCTTCTGGGCTCTCAGCGGCGGTGGTGCTGGC
ACTTACGGTATCGTCTGGTCCATGACCTCCAAGGCACACCCGGGAACCCCCGTCTCTGGCCTGAACCTGACCTAC
ACGAATGATGGGATCTCGCAAGACACTTTCTTCAATACCATCGAGACCTTCCACGCCGCCCTGCCCGCTATCGTC
GACGCAGGTGCTATGAGCGTCTGGTACTTCACCAACACCAGCTTCTCTATTGCTCCGATCACCGGTCCCAACATC
CCTGTCGCTGACTTGGTGACGCTGCTCAAGCCTTTCACCAACAGCCTCGACAAGCTCGGCATCGAGTACACCATG
GTTTCCAAGCAATACGACAGCTACTACAGCCAGTTCAAGGACATGCAAGGCACCATTGAGGTTGGCACGGCCCAA
TATGGCGGCTGGCTGGTTCCGAGATCGGTCGTTCAGAACAACAATCACGCCCTGTTGACTGCCTACCGTGAGATC
ACCGAGGCGGGCGGCACTTTTATCGGCGTCGGCTTGAACGTCTCCCACAAGGTATCTGGAGACGTCCACAACGCG
GTCCTCCCTGCTTGGCGCGAAGCCTTGATTGATACTACTTTGACGACCCCATGGGAGTGGGACAACTCTGCTCTC
ATGTTGGAGCGCCAGCGCCAAATGACCGAGGATTTCATTCCGAAGCTGACTGCGCTTTCTCCCAAGTCCGGTGCT
TATATGAATGAGGGTGACTTCCAACAGCCTAACTTCAAGAAGGTCTTCTATGGTACCAACTATGATACCTTGCGC
AAGGTCAAGGCTAAATATGATCCGAACAATATCTTCTACGCTAGAACCGCTGTCGGGTCTGACGAGTGGACCGAG
AGTAAGGATGGCCGCTTGTGCAAAGCAACCTAG
Transcript >Pro_DTO377G3_2|g7379.t1
ATGTTTTTCCGCGCATCCCTCATTGCTTCGCTGTTGGCAGTTCTGCCTCAGGCTTCAGCCTCGGCATGCCGTTGC
TTTCCCGGTGATGCTTGCTGGCCCACCGAGGATCAATGGTCCCAATTGAACAAAACCGTCGATGGTCGACTAGTC
AAGACCGTCCCTCTCGGCACACCTTGCCATGCGCCGAACTACAATTCCGAGACCTGTGCAGTCTTGAAGGATGGG
TGGCTACTTCCTGAGGAGCACTATGAATCATCTTCCTCGGTTATGGCGCCGTTCTTTGCCGAGGGTGCTTGCGAT
CCGTTCCACCCCGTCTCAAAGCCCTGCACCCTGGGTAACTATGTGCGCTACAGCGTGAATGTCACCAGCCCGGCT
CACATTTCCAACGCTGTGAAATTCGCAACGAAGCACAACATCCGTCTTGTCATCCGTAACACCGGCCACGACTAC
AATGGCCGATCCACTGGCGCTGGAGCGCTTGCAATCTGGACTCACCACCTGAAGGATCTGTCAATCGACTCCTAC
CATGACAAGCACTACACCGGAAAGGCCATTACCATGGGCGCTGGAATCCAAGGCCACGAAGCCTACGAGATCGCC
GAGGAAACTGGTTACCAGGTCGTCGGCGGCGAATGTCCCACCGTTGGTCTTGCCGGTGGCTACACCCAAGGAGGC
GGTCACTCCGCACTGGGCTCCCGCTATGGCCTGGCCGCCGATCAAGTCCTGAAATGGGAGGTCATTGACGGCCAA
GGCAACTGCATCACGGCTACCCGCGACAATGAGCACTCTGACATCTTCTGGGCTCTCAGCGGCGGTGGTGCTGGC
ACTTACGGTATCGTCTGGTCCATGACCTCCAAGGCACACCCGGGAACCCCCGTCTCTGGCCTGAACCTGACCTAC
ACGAATGATGGGATCTCGCAAGACACTTTCTTCAATACCATCGAGACCTTCCACGCCGCCCTGCCCGCTATCGTC
GACGCAGGTGCTATGAGCGTCTGGTACTTCACCAACACCAGCTTCTCTATTGCTCCGATCACCGGTCCCAACATC
CCTGTCGCTGACTTGGTGACGCTGCTCAAGCCTTTCACCAACAGCCTCGACAAGCTCGGCATCGAGTACACCATG
GTTTCCAAGCAATACGACAGCTACTACAGCCAGTTCAAGGACATGCAAGGCACCATTGAGGTTGGCACGGCCCAA
TATGGCGGCTGGCTGGTTCCGAGATCGGTCGTTCAGAACAACAATCACGCCCTGTTGACTGCCTACCGTGAGATC
ACCGAGGCGGGCGGCACTTTTATCGGCGTCGGCTTGAACGTCTCCCACAAGGTATCTGGAGACGTCCACAACGCG
GTCCTCCCTGCTTGGCGCGAAGCCTTGATTGATACTACTTTGACGACCCCATGGGAGTGGGACAACTCTGCTCTC
ATGTTGGAGCGCCAGCGCCAAATGACCGAGGATTTCATTCCGAAGCTGACTGCGCTTTCTCCCAAGTCCGGTGCT
TATATGAATGAGGGTGACTTCCAACAGCCTAACTTCAAGAAGGTCTTCTATGGTACCAACTATGATACCTTGCGC
AAGGTCAAGGCTAAATATGATCCGAACAATATCTTCTACGCTAGAACCGCTGTCGGGTCTGACGAGTGGACCGAG
AGTAAGGATGGCCGCTTGTGCAAAGCAACCTAG
Gene >Pro_DTO377G3_2|g7379.t1
ATGTTTTTCCGCGCATCCCTCATTGCTTCGCTGTTGGCAGTTCTGCCTCAGGCTTCAGCCTCGGCATGCCGTTGC
TTTCCCGGTGATGCTTGCTGGCCCACCGAGGATCAATGGTCCCAATTGAACAAAACCGTCGATGGTCGACTAGTC
AAGACCGTCCCTCTCGGCACACCTTGCCATGCGCCGAACTACAATTCCGAGACCTGTGCAGTCTTGAAGGATGGG
TGGCTACTTCCTGAGGAGCAGTATGTGACTCTGCATATAGAATAACACGAAAGGGCCAGTACTGACATATGTTTC
TGACAGCTATGAATCATCTTCCTCGGTTATGGCGCCGTTCTTTGCCGAGGGTGCTTGCGATCCGTTCCACCCCGT
CTCAAAGCCCTGCACCCTGGGTAACTATGTGCGCTACAGCGTGAATGTCACCAGCCCGGCTCACATTTCCAACGC
TGTGAAATTCGCAACGAAGCACAACATCCGTCTTGTCATCCGTAACACCGGCCACGACTACAATGGCCGATCCAC
TGGCGCTGGAGCGCTTGCAATCTGGACTCACCACCTGAAGGATCTGTCAATCGACTCCTACCATGACAAGCACTA
CACCGGAAAGGCCATTACCATGGGCGCTGGAATCCAAGGCCACGAAGCCTACGAGATCGCCGAGGAAACTGGTTA
CCAGGTCGTCGGCGGCGAATGTCCCACCGTTGGTCTTGCCGGTGGCTACACCCAAGGAGGCGGTCACTCCGCACT
GGGCTCCCGCTATGGCCTGGCCGCCGATCAAGTCCTGAAATGGGAGGTCATTGACGGCCAAGGCAACTGCATCAC
GGCTACCCGCGACAATGAGCACTCTGACATCTTCTGGGCTCTCAGCGGCGGTGGTGCTGGCACTTACGGTATCGT
CTGGTCCATGACCTCCAAGGCACACCCGGGAACCCCCGTCTCTGGCCTGAACCTGACCTACACGAATGATGGGAT
CTCGCAAGACACTTTCTTCAATACCATCGAGACCTTCCACGCCGCCCTGCCCGCTATCGTCGACGCAGGTGCTAT
GAGCGTCTGGTACTTCACCAACACCAGCTTCTCTATTGCTCCGATCACCGGTCCCAACATCCCTGTCGCTGACTT
GGTGACGCTGCTCAAGCCTTTCACCAACAGCCTCGACAAGCTCGGCATCGAGTACACCATGGTTTCCAAGCAATA
CGACAGCTACTACAGCCAGTTCAAGGACATGCAAGGCACCATTGAGGTTGGCACGGCCCAATATGGCGGCTGGCT
GGTTCCGAGATCGGTCGTTCAGAACAACAATCACGCCCTGTTGACTGCCTACCGTGAGATCACCGAGGCGGGCGG
CACTTTTATCGGCGTCGGCTTGAACGTCTCCCACAAGGTATCTGGAGACGTCCACAACGCGGTCCTCCCTGCTTG
GCGCGAAGCCTTGATTGATACTACTTTGACGACCCCATGGGAGTGGGACAACTCTGCTCTCATGTTGGAGCGCCA
GCGCCAAATGACCGAGGATTTCATTCCGAAGCTGACTGCGCTTTCTCCCAAGTCCGGTGCTTATATGAATGAGGT
ATGTAAACTGATATTTAGCTATGATTCCCTTCATTATTGTGTACGCATGCTTATCATTTTGGCAGGGTGACTTCC
AACAGCCTAACTTCAAGAAGGTCTTCTATGGTACCAACTATGATACCTTGCGCAAGGTCAAGGCTAAATATGATC
CGAACAATATCTTCTACGCTAGAACCGCTGTCGGGTCTGACGAGTGGACCGAGAGTAAGGATGGCCGCTTGTGCA
AAGCAACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail