Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7373.t1
Gene name
Locationscaffold_22:371179..372086
Strand+
Gene length (bp)907
Transcript length (bp)837
Coding sequence length (bp)837
Protein length (aa) 279

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.0E-19 35 104

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 15.22 6.07 24.36
5d_25C Five days - 25 degrees Celsius 19.60 8.29 30.91
7d_25C Seven days - 25 degrees Celsius 21.49 9.24 33.74
10d_25C Ten days - 25 degrees Celsius 25.13 11.29 38.97
7d_15C Seven days - 15 degrees Celsius 20.51 8.68 32.35
7d_30C Seven days - 30 degrees Celsius 21.34 9.24 33.43

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.518456 no
3d_25C 7d_25C 0.321934 no
3d_25C 7d_15C 0.427906 no
3d_25C 7d_30C 0.340024 no
3d_25C 10d_25C 0.125542 no
5d_25C 7d_25C 0.842391 no
5d_25C 7d_15C 0.928910 no
5d_25C 7d_30C 0.857509 no
5d_25C 10d_25C 0.514176 no
7d_25C 7d_15C 0.924275 no
7d_25C 7d_30C 0.988456 no
7d_25C 10d_25C 0.702843 no
7d_15C 7d_30C 0.938118 no
7d_15C 10d_25C 0.617252 no
7d_30C 10d_25C 0.691533 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7373.t1
MNSIRQVQALNKRELEHAIPPEASWHADYRDTAYIYIGGLPFDLSEGDIIAIFSQYGEPVHVNLVRDKETGKSKG
FAFLKYEDQRSTDLAVDNLGGATVMGRLLRVDHARYKRKDDEEEQDNVAKLMGDPGVSENKSKEDDRRRGTAIEE
RRPMLKEERELEELIRNHDEEDPMKEFLIEEKKEEIATAIQLWNSTKKSSRRRDDSRERSSRHHRRHRSRSPRER
RHRDDRSMDRERRSRRRSSERGEKSKKDRSPRKSRSPEPRRHRSDRDRHDRRH*
Coding >Pro_DTO377G3_2|g7373.t1
ATGAATTCTATTCGCCAGGTCCAGGCGCTCAATAAGCGCGAGCTTGAGCACGCGATACCCCCAGAGGCATCATGG
CATGCAGATTATCGCGACACAGCCTATATCTACATCGGAGGACTTCCATTTGATCTATCCGAAGGTGACATAATT
GCGATTTTCTCACAGTATGGGGAACCGGTGCATGTCAACCTAGTCCGCGACAAGGAAACAGGCAAGAGCAAGGGA
TTTGCCTTTCTGAAATATGAGGACCAGCGCAGCACAGATCTTGCTGTGGATAACCTCGGTGGCGCAACTGTCATG
GGCCGTTTGCTTCGAGTGGATCATGCGCGCTACAAGCGGAAGGACGACGAGGAAGAGCAGGACAATGTCGCCAAG
CTAATGGGAGATCCCGGCGTCAGTGAGAACAAGAGCAAGGAGGACGACCGGAGGAGGGGAACCGCAATAGAAGAG
AGGCGACCTATGCTGAAAGAGGAAAGGGAACTGGAAGAATTGATTCGGAACCACGACGAGGAAGACCCGATGAAG
GAATTCCTCATTGAGGAGAAGAAAGAAGAGATCGCCACTGCAATCCAGCTGTGGAACAGCACCAAGAAGTCGTCT
CGACGACGCGATGACAGCAGAGAACGATCAAGCCGGCATCACCGCCGACACCGTTCTCGTTCTCCTCGCGAGCGA
AGACATAGAGATGATCGCTCTATGGATAGGGAGCGGCGATCTCGCCGTAGGTCATCCGAAAGAGGAGAAAAATCT
AAAAAGGACCGCTCGCCGAGGAAATCGCGCTCGCCCGAACCCCGAAGACACCGGAGTGATCGGGATAGACATGAT
CGCCGCCATTGA
Transcript >Pro_DTO377G3_2|g7373.t1
ATGAATTCTATTCGCCAGGTCCAGGCGCTCAATAAGCGCGAGCTTGAGCACGCGATACCCCCAGAGGCATCATGG
CATGCAGATTATCGCGACACAGCCTATATCTACATCGGAGGACTTCCATTTGATCTATCCGAAGGTGACATAATT
GCGATTTTCTCACAGTATGGGGAACCGGTGCATGTCAACCTAGTCCGCGACAAGGAAACAGGCAAGAGCAAGGGA
TTTGCCTTTCTGAAATATGAGGACCAGCGCAGCACAGATCTTGCTGTGGATAACCTCGGTGGCGCAACTGTCATG
GGCCGTTTGCTTCGAGTGGATCATGCGCGCTACAAGCGGAAGGACGACGAGGAAGAGCAGGACAATGTCGCCAAG
CTAATGGGAGATCCCGGCGTCAGTGAGAACAAGAGCAAGGAGGACGACCGGAGGAGGGGAACCGCAATAGAAGAG
AGGCGACCTATGCTGAAAGAGGAAAGGGAACTGGAAGAATTGATTCGGAACCACGACGAGGAAGACCCGATGAAG
GAATTCCTCATTGAGGAGAAGAAAGAAGAGATCGCCACTGCAATCCAGCTGTGGAACAGCACCAAGAAGTCGTCT
CGACGACGCGATGACAGCAGAGAACGATCAAGCCGGCATCACCGCCGACACCGTTCTCGTTCTCCTCGCGAGCGA
AGACATAGAGATGATCGCTCTATGGATAGGGAGCGGCGATCTCGCCGTAGGTCATCCGAAAGAGGAGAAAAATCT
AAAAAGGACCGCTCGCCGAGGAAATCGCGCTCGCCCGAACCCCGAAGACACCGGAGTGATCGGGATAGACATGAT
CGCCGCCATTGA
Gene >Pro_DTO377G3_2|g7373.t1
ATGAATTCTATTCGCCAGGTCCAGGCGCTCAATAAGCGCGAGCTTGAGCACGCGATGTAAGTAGAACTCATGTGA
AGCTCCCGCAAAGCTCTTTTTCCCACTGACAGTCTTACGTTCCACCTATAGACCCCCAGAGGCATCATGGCATGC
AGATTATCGCGACACAGCCTATATCTACATCGGAGGACTTCCATTTGATCTATCCGAAGGTGACATAATTGCGAT
TTTCTCACAGTATGGGGAACCGGTGCATGTCAACCTAGTCCGCGACAAGGAAACAGGCAAGAGCAAGGGATTTGC
CTTTCTGAAATATGAGGACCAGCGCAGCACAGATCTTGCTGTGGATAACCTCGGTGGCGCAACTGTCATGGGCCG
TTTGCTTCGAGTGGATCATGCGCGCTACAAGCGGAAGGACGACGAGGAAGAGCAGGACAATGTCGCCAAGCTAAT
GGGAGATCCCGGCGTCAGTGAGAACAAGAGCAAGGAGGACGACCGGAGGAGGGGAACCGCAATAGAAGAGAGGCG
ACCTATGCTGAAAGAGGAAAGGGAACTGGAAGAATTGATTCGGAACCACGACGAGGAAGACCCGATGAAGGAATT
CCTCATTGAGGAGAAGAAAGAAGAGATCGCCACTGCAATCCAGCTGTGGAACAGCACCAAGAAGTCGTCTCGACG
ACGCGATGACAGCAGAGAACGATCAAGCCGGCATCACCGCCGACACCGTTCTCGTTCTCCTCGCGAGCGAAGACA
TAGAGATGATCGCTCTATGGATAGGGAGCGGCGATCTCGCCGTAGGTCATCCGAAAGAGGAGAAAAATCTAAAAA
GGACCGCTCGCCGAGGAAATCGCGCTCGCCCGAACCCCGAAGACACCGGAGTGATCGGGATAGACATGATCGCCG
CCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail