Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7371.t1
Gene name
Locationscaffold_22:366709..368468
Strand+
Gene length (bp)1759
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01564 Spermine_synth Spermine/spermidine synthase domain 1.2E-08 308 414

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 12 31 19
2 46 63 17
3 76 93 17
4 103 125 22
5 185 207 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 52.41 31.67 73.16
5d_25C Five days - 25 degrees Celsius 48.51 29.05 67.97
7d_25C Seven days - 25 degrees Celsius 43.23 25.74 60.73
10d_25C Ten days - 25 degrees Celsius 48.63 29.24 68.01
7d_15C Seven days - 15 degrees Celsius 44.05 26.24 61.85
7d_30C Seven days - 30 degrees Celsius 60.87 36.93 84.81

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.801144 no
3d_25C 7d_25C 0.447180 no
3d_25C 7d_15C 0.499801 no
3d_25C 7d_30C 0.577913 no
3d_25C 10d_25C 0.808974 no
5d_25C 7d_25C 0.692133 no
5d_25C 7d_15C 0.754035 no
5d_25C 7d_30C 0.359165 no
5d_25C 10d_25C 0.994996 no
7d_25C 7d_15C 0.960904 no
7d_25C 7d_30C 0.129711 no
7d_25C 10d_25C 0.683497 no
7d_15C 7d_30C 0.157056 no
7d_15C 10d_25C 0.738815 no
7d_30C 10d_25C 0.362326 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7371.t1
MSPQDMLRHIDARRFTTGVVLLILLAFYSPLSKLVLSPTYGSFPAHIFHNFGVAISGGIGWLLKDKILKRMGRLG
GFMLPVLAFWVPTLQYFIKQQSSKIGNPTGPVVTELCGYYPLVLLTVAYAGKQIQTALRLEAQGDVIVEHVPLIG
TYIFYSAGDHIAQYVLSWIVGTSVIFTRVGMQMLLAACYSVLIPSKWLVLAIPSIIFSVTSNVHFAGISGVNSAI
EHEGYSLLARQEAYTGYISVLENHNEGFRVMRCDHSLLGGQWTKLAPGYRPEVDDPIYAVFAMLEAVRLVEPDNG
VSRVDADSKALVIGLGVGTTPSALIKHGIETTIVEIDPVVHKFATQYFNLPPNHISVIEDAVKFVKKAQSSPNTP
QYDYIVHDVFTGGAEPADLFTYEFLSGLHSLLKEDGAIAINYAGDVALYPTGLVVRTINAVFPSCRIFREEPTGD
DEDTDFTNLVLFCKKSSNTPIQFRDPVPADFLRSKSRESYLVPKHELDPAIFASWPKGGRPILIAKQAGRLHKYQ
DRSAIKHWSIMRKVMPDAVWENW*
Coding >Pro_DTO377G3_2|g7371.t1
ATGTCCCCCCAGGACATGTTGCGGCACATTGATGCCCGGCGGTTCACTACCGGTGTGGTTTTGCTGATCCTGCTT
GCCTTCTACTCGCCCCTTTCGAAGCTTGTCTTGTCTCCAACATATGGATCCTTCCCCGCGCATATCTTCCATAAT
TTTGGAGTGGCCATCTCCGGCGGAATCGGGTGGCTACTGAAGGACAAGATTCTCAAGCGCATGGGCCGTCTAGGT
GGCTTTATGCTCCCTGTGTTGGCATTCTGGGTTCCGACTCTCCAGTACTTTATCAAGCAGCAAAGCTCTAAGATT
GGCAACCCCACAGGCCCAGTGGTCACAGAACTTTGTGGTTACTACCCTCTGGTGCTGTTGACCGTCGCCTATGCC
GGAAAGCAAATCCAGACTGCTTTGAGACTCGAAGCGCAGGGCGACGTGATAGTTGAGCATGTGCCCCTGATAGGT
ACATATATATTCTATTCGGCTGGCGACCACATTGCCCAATATGTTCTTTCATGGATTGTTGGGACCTCGGTTATT
TTCACCAGAGTTGGCATGCAAATGCTTCTCGCGGCCTGTTACTCTGTGCTCATCCCATCAAAATGGCTAGTCCTG
GCCATTCCCTCTATCATTTTCTCAGTGACTTCGAACGTACATTTCGCTGGAATTAGTGGTGTCAATTCCGCGATT
GAGCACGAAGGTTATTCTCTTTTGGCACGACAGGAAGCTTACACTGGGTACATTTCTGTTTTGGAAAACCACAAT
GAAGGATTCCGAGTTATGCGCTGTGACCACAGTCTGCTTGGTGGACAGTGGACCAAGCTGGCACCAGGCTACCGA
CCTGAGGTGGATGACCCTATCTACGCAGTCTTTGCCATGCTCGAGGCTGTCCGTCTGGTTGAGCCGGATAATGGC
GTTTCCCGCGTTGACGCAGACAGCAAGGCGTTAGTCATCGGTCTTGGAGTCGGCACAACACCCTCTGCGCTCATC
AAACACGGCATTGAAACTACCATCGTCGAAATCGACCCTGTGGTGCACAAGTTCGCCACTCAATATTTCAACCTC
CCGCCAAACCACATCTCCGTGATTGAAGATGCCGTAAAATTCGTCAAGAAGGCACAGTCCTCCCCGAATACACCC
CAATATGACTACATCGTCCATGATGTATTCACTGGAGGCGCCGAGCCCGCCGATCTCTTCACATACGAGTTCCTG
TCAGGCCTTCACTCGCTCCTCAAGGAAGACGGTGCCATTGCCATTAACTACGCCGGTGATGTGGCCCTCTACCCA
ACCGGTCTCGTCGTCCGCACCATCAATGCCGTTTTCCCATCTTGCCGCATCTTCCGCGAAGAACCCACTGGAGAT
GACGAAGATACCGACTTCACCAACCTGGTCCTTTTCTGCAAGAAGAGCTCTAACACACCGATTCAATTCCGTGAC
CCTGTCCCGGCTGACTTCCTGCGCAGCAAGTCTCGTGAAAGCTACCTTGTTCCCAAGCACGAACTCGACCCTGCC
ATCTTTGCCTCTTGGCCCAAGGGCGGTAGACCAATTTTGATTGCTAAGCAGGCCGGAAGATTGCACAAGTACCAG
GATCGCAGTGCGATCAAGCACTGGTCTATCATGCGCAAGGTTATGCCTGATGCCGTGTGGGAGAACTGGTGA
Transcript >Pro_DTO377G3_2|g7371.t1
ATGTCCCCCCAGGACATGTTGCGGCACATTGATGCCCGGCGGTTCACTACCGGTGTGGTTTTGCTGATCCTGCTT
GCCTTCTACTCGCCCCTTTCGAAGCTTGTCTTGTCTCCAACATATGGATCCTTCCCCGCGCATATCTTCCATAAT
TTTGGAGTGGCCATCTCCGGCGGAATCGGGTGGCTACTGAAGGACAAGATTCTCAAGCGCATGGGCCGTCTAGGT
GGCTTTATGCTCCCTGTGTTGGCATTCTGGGTTCCGACTCTCCAGTACTTTATCAAGCAGCAAAGCTCTAAGATT
GGCAACCCCACAGGCCCAGTGGTCACAGAACTTTGTGGTTACTACCCTCTGGTGCTGTTGACCGTCGCCTATGCC
GGAAAGCAAATCCAGACTGCTTTGAGACTCGAAGCGCAGGGCGACGTGATAGTTGAGCATGTGCCCCTGATAGGT
ACATATATATTCTATTCGGCTGGCGACCACATTGCCCAATATGTTCTTTCATGGATTGTTGGGACCTCGGTTATT
TTCACCAGAGTTGGCATGCAAATGCTTCTCGCGGCCTGTTACTCTGTGCTCATCCCATCAAAATGGCTAGTCCTG
GCCATTCCCTCTATCATTTTCTCAGTGACTTCGAACGTACATTTCGCTGGAATTAGTGGTGTCAATTCCGCGATT
GAGCACGAAGGTTATTCTCTTTTGGCACGACAGGAAGCTTACACTGGGTACATTTCTGTTTTGGAAAACCACAAT
GAAGGATTCCGAGTTATGCGCTGTGACCACAGTCTGCTTGGTGGACAGTGGACCAAGCTGGCACCAGGCTACCGA
CCTGAGGTGGATGACCCTATCTACGCAGTCTTTGCCATGCTCGAGGCTGTCCGTCTGGTTGAGCCGGATAATGGC
GTTTCCCGCGTTGACGCAGACAGCAAGGCGTTAGTCATCGGTCTTGGAGTCGGCACAACACCCTCTGCGCTCATC
AAACACGGCATTGAAACTACCATCGTCGAAATCGACCCTGTGGTGCACAAGTTCGCCACTCAATATTTCAACCTC
CCGCCAAACCACATCTCCGTGATTGAAGATGCCGTAAAATTCGTCAAGAAGGCACAGTCCTCCCCGAATACACCC
CAATATGACTACATCGTCCATGATGTATTCACTGGAGGCGCCGAGCCCGCCGATCTCTTCACATACGAGTTCCTG
TCAGGCCTTCACTCGCTCCTCAAGGAAGACGGTGCCATTGCCATTAACTACGCCGGTGATGTGGCCCTCTACCCA
ACCGGTCTCGTCGTCCGCACCATCAATGCCGTTTTCCCATCTTGCCGCATCTTCCGCGAAGAACCCACTGGAGAT
GACGAAGATACCGACTTCACCAACCTGGTCCTTTTCTGCAAGAAGAGCTCTAACACACCGATTCAATTCCGTGAC
CCTGTCCCGGCTGACTTCCTGCGCAGCAAGTCTCGTGAAAGCTACCTTGTTCCCAAGCACGAACTCGACCCTGCC
ATCTTTGCCTCTTGGCCCAAGGGCGGTAGACCAATTTTGATTGCTAAGCAGGCCGGAAGATTGCACAAGTACCAG
GATCGCAGTGCGATCAAGCACTGGTCTATCATGCGCAAGGTTATGCCTGATGCCGTGTGGGAGAACTGGTGA
Gene >Pro_DTO377G3_2|g7371.t1
ATGTCCCCCCAGGACATGTTGCGGCACATTGATGCCCGGCGGTTCACTACCGGTGTGGTTTTGCTGATCCTGCTT
GCCTTCTACTCGCCCCTTTCGAAGCTTGTCTTGTCTCCAACATATGGATCCTTCCCCGCGCATATCTTCCATAAT
TTTGGAGTGGCCATCTCCGGCGGAATCGGGTGGCTACTGAAGGACAAGATTCTCAAGCGCATGGGCCGTCTAGGT
GGCTTTATGCTCCCTGTGTTGGCATTCTGGGTTCCGACTCTCCAGTACTTTATCAAGCAGCAAAGCTCTAAGATT
GGCAACCCCACAGGCCCAGTGGTCACAGAACTTTGTGGTTACTACCCTCTGGTGCTGTTGACCGTCGCCTATGCC
GGAAAGCAAATCCAGACTGCTTTGAGACTCGAAGCGCAGGGCGACGTGATAGTTGAGCATGTGCCCCTGATAGGT
ACATATATATTCTATTCGGCTGGCGACCACATTGCCCAATATGTTCTTTCATGGATTGTTGGGACCTCGGTTATT
TTCACCAGAGTTGGCATGCAAATGCTTCTCGCGGCCTGTTACTCTGTGCTCATCCCATCAAAATGGCTAGTCCTG
GCCATTCCCTCTATCATTTTCTCAGTGACTTCGAACGTACATTTCGCTGGAATTAGTGGTGTCAATTCCGCGATT
GAGCACGAAGGTTATTCTCTTTTGGCACGACAGGAAGCTTACACTGGGTACATTTCTGTTTTGGAAAACCACAAT
GAAGGATTCCGAGTTATGCGCTGTGACCACAGTCTGCTTGGTGGACAGTGGACCAAGCTGGCACCAGGCTACCGA
CCTGAGGTGGATGACCCTATCTACGCAGTCTTTGCCATGCTCGAGGCTGTCCGTCTGGTTGAGCCGGATAATGGC
GTTTCCCGCGTTGACGCAGACAGCAAGGCGTTAGTCATGTAAGAATTATGCAAAAAGGATCGATCGCCCAGTTTA
CTGACAGAAAATAGCGGTCTTGGAGTCGGCACAACACCCTCTGCGCTCATCAAACACGGCATTGAAACTACCATC
GTCGAAATCGACCCTGTGGTGCACAAGTTCGCCACTCAATATTTCAACCTCCCGCCAAACCACATCTCCGTGATT
GAAGATGCCGTAAAATTCGTCAAGAAGGCACAGTCCTCCCCGAATACACCCCAATATGACTACATCGTCCATGAT
GTATTCACTGGAGGCGCCGAGCCCGCCGATCTCTTCACATACGAGTTCCTGTCAGGCCTTCACTCGCTCCTCAAG
GAAGACGGTGCCATTGCCATTGTGAGTTTCATCAAGGCAACAAGCCCCCCAAATCAACTCCAGACTAATGAATGG
AACACAGAACTACGCCGGTGATGTGGCCCTCTACCCAACCGGTCTCGTCGTCCGCACCATCAATGCCGTTTTCCC
ATCTTGCCGCATCTTCCGCGAAGAACCCACTGGAGATGACGAAGATACCGACTTCACCAACCTGGTCCTTTTCTG
CAAGAAGAGCTCTAACACACCGATTCAATTCCGTGACCCTGTCCCGGCTGACTTCCTGCGCAGCAAGTCTCGTGA
AAGCTACCTTGTTCCCAAGCACGAACTCGACCCTGCCATCTTTGCCTCTTGGCCCAAGGGCGGTAGACCAATTTT
GATTGCTAAGCAGGCCGGAAGATTGCACAAGTACCAGGATCGCAGTGCGATCAAGCACTGGTCTATCATGCGCAA
GGTTATGCCTGATGCCGTGTGGGAGAACTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail