Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g737.t1
Gene name
Locationscaffold_01:1891054..1892527
Strand+
Gene length (bp)1473
Transcript length (bp)1473
Coding sequence length (bp)1473
Protein length (aa) 491

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.8E-46 34 390
PF05977 MFS_3 Transmembrane secretion effector 5.1E-06 82 205

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 27 49 22
2 69 91 22
3 104 126 22
4 130 148 18
5 160 182 22
6 187 209 22
7 274 296 22
8 340 359 19
9 372 394 22
10 414 436 22
11 449 471 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g737.t1
MGFLTWPFSHEKEEKRPKFVELRSSKWFIMFVVAFATGTDIFMYGLIVPVTPTALKDKVGISEDDVQSWTSILLA
LYSAALLAFAPVVGYIADRAESRRWPLLFGLVALAAATALLCVGTNIALWIVGRLFQGAAAAVVWTAGLALIVDT
IGKDDLGQAIGYVSMAISIGTLAGPLLGGVVYENGGYYAVFGLAFGFIALDIILRLLLIEKRHAIKWLAPEMTPL
SVTEKKSGEVLEHPVLPTNGSESRESQPPSPPSRSAFGRVAILLSSPRLVVSVWGYFILSIVLTSFDSVLPLFVQ
ETFKWQQSGQGLIFISLMVPHVLDPLMGFVIDKYPKSCRYLAAGAFLTVVPVLVLLRFVKDNSMQHKILLCALLA
CVGVCFAVAMPPLIVEVFFAVKEKEDKTPDIFGRGGAMALAFGLSNMGFATGSLIGPFFAGYIRQEAGWGAMGWA
LGLIVGVSSLPILLFVGGWILKKPLESDTEGQLMDSAPVP*
Coding >Pro_DTO377G3_2|g737.t1
ATGGGGTTCTTGACGTGGCCCTTCTCACATGAGAAGGAGGAAAAGAGACCCAAGTTCGTCGAGCTAAGGTCGTCA
AAATGGTTTATTATGTTCGTCGTGGCCTTTGCTACCGGGACGGACATCTTCATGTACGGTCTTATCGTACCGGTC
ACGCCAACAGCATTGAAAGACAAAGTGGGAATCTCAGAGGATGATGTCCAAAGCTGGACATCCATTCTCCTTGCC
CTGTACTCGGCTGCTTTGTTAGCCTTTGCCCCTGTTGTCGGGTACATTGCTGACCGAGCCGAGTCCCGTCGATGG
CCTTTGCTGTTTGGTCTCGTTGCGTTGGCCGCTGCAACAGCCTTACTGTGTGTCGGTACCAATATCGCGTTGTGG
ATTGTTGGTCGCTTGTTTCAAGGCGCTGCCGCTGCGGTGGTATGGACGGCCGGCCTGGCACTGATAGTAGACACT
ATCGGAAAAGACGACCTTGGCCAAGCCATTGGCTATGTCTCCATGGCTATCAGCATCGGAACGCTAGCTGGACCT
CTTCTCGGTGGCGTTGTCTACGAGAATGGTGGTTATTATGCCGTTTTCGGTCTTGCTTTCGGTTTCATCGCCCTC
GATATCATCTTACGATTGCTGTTGATCGAGAAAAGACATGCTATTAAATGGCTTGCGCCGGAGATGACACCGCTG
TCCGTGACGGAGAAGAAGTCAGGGGAAGTTTTAGAACATCCCGTCTTGCCAACCAATGGCTCTGAATCCCGTGAA
TCACAACCGCCTTCTCCCCCCTCACGGAGCGCGTTCGGACGTGTCGCTATTTTGTTGAGCTCACCCCGTCTCGTC
GTATCCGTCTGGGGATACTTTATCTTGTCAATCGTCCTGACCTCATTCGACAGTGTCCTTCCACTCTTCGTGCAA
GAGACATTCAAGTGGCAGCAAAGTGGCCAGGGACTAATCTTCATCTCGCTCATGGTGCCGCACGTCTTAGACCCA
CTGATGGGGTTTGTTATTGACAAGTACCCCAAATCCTGTCGCTACCTCGCTGCAGGCGCATTTCTCACCGTCGTT
CCCGTTCTGGTGCTTCTGCGTTTTGTCAAGGACAACTCGATGCAGCACAAGATTCTATTGTGTGCCCTCCTCGCT
TGTGTTGGGGTATGCTTTGCGGTGGCTATGCCACCTCTCATTGTGGAGGTGTTCTTCGCTGTGAAGGAGAAGGAA
GATAAAACTCCTGATATCTTCGGTCGCGGTGGCGCTATGGCTCTGGCTTTTGGGCTGTCGAATATGGGGTTCGCG
ACCGGGAGTCTGATCGGCCCATTCTTTGCGGGTTATATTCGCCAGGAAGCTGGCTGGGGTGCGATGGGTTGGGCA
TTGGGGTTGATAGTGGGCGTATCATCTCTCCCAATCCTGTTGTTCGTGGGTGGCTGGATCTTGAAAAAGCCGCTC
GAGTCAGACACTGAAGGCCAGTTGATGGACAGCGCCCCTGTCCCATAA
Transcript >Pro_DTO377G3_2|g737.t1
ATGGGGTTCTTGACGTGGCCCTTCTCACATGAGAAGGAGGAAAAGAGACCCAAGTTCGTCGAGCTAAGGTCGTCA
AAATGGTTTATTATGTTCGTCGTGGCCTTTGCTACCGGGACGGACATCTTCATGTACGGTCTTATCGTACCGGTC
ACGCCAACAGCATTGAAAGACAAAGTGGGAATCTCAGAGGATGATGTCCAAAGCTGGACATCCATTCTCCTTGCC
CTGTACTCGGCTGCTTTGTTAGCCTTTGCCCCTGTTGTCGGGTACATTGCTGACCGAGCCGAGTCCCGTCGATGG
CCTTTGCTGTTTGGTCTCGTTGCGTTGGCCGCTGCAACAGCCTTACTGTGTGTCGGTACCAATATCGCGTTGTGG
ATTGTTGGTCGCTTGTTTCAAGGCGCTGCCGCTGCGGTGGTATGGACGGCCGGCCTGGCACTGATAGTAGACACT
ATCGGAAAAGACGACCTTGGCCAAGCCATTGGCTATGTCTCCATGGCTATCAGCATCGGAACGCTAGCTGGACCT
CTTCTCGGTGGCGTTGTCTACGAGAATGGTGGTTATTATGCCGTTTTCGGTCTTGCTTTCGGTTTCATCGCCCTC
GATATCATCTTACGATTGCTGTTGATCGAGAAAAGACATGCTATTAAATGGCTTGCGCCGGAGATGACACCGCTG
TCCGTGACGGAGAAGAAGTCAGGGGAAGTTTTAGAACATCCCGTCTTGCCAACCAATGGCTCTGAATCCCGTGAA
TCACAACCGCCTTCTCCCCCCTCACGGAGCGCGTTCGGACGTGTCGCTATTTTGTTGAGCTCACCCCGTCTCGTC
GTATCCGTCTGGGGATACTTTATCTTGTCAATCGTCCTGACCTCATTCGACAGTGTCCTTCCACTCTTCGTGCAA
GAGACATTCAAGTGGCAGCAAAGTGGCCAGGGACTAATCTTCATCTCGCTCATGGTGCCGCACGTCTTAGACCCA
CTGATGGGGTTTGTTATTGACAAGTACCCCAAATCCTGTCGCTACCTCGCTGCAGGCGCATTTCTCACCGTCGTT
CCCGTTCTGGTGCTTCTGCGTTTTGTCAAGGACAACTCGATGCAGCACAAGATTCTATTGTGTGCCCTCCTCGCT
TGTGTTGGGGTATGCTTTGCGGTGGCTATGCCACCTCTCATTGTGGAGGTGTTCTTCGCTGTGAAGGAGAAGGAA
GATAAAACTCCTGATATCTTCGGTCGCGGTGGCGCTATGGCTCTGGCTTTTGGGCTGTCGAATATGGGGTTCGCG
ACCGGGAGTCTGATCGGCCCATTCTTTGCGGGTTATATTCGCCAGGAAGCTGGCTGGGGTGCGATGGGTTGGGCA
TTGGGGTTGATAGTGGGCGTATCATCTCTCCCAATCCTGTTGTTCGTGGGTGGCTGGATCTTGAAAAAGCCGCTC
GAGTCAGACACTGAAGGCCAGTTGATGGACAGCGCCCCTGTCCCATAA
Gene >Pro_DTO377G3_2|g737.t1
ATGGGGTTCTTGACGTGGCCCTTCTCACATGAGAAGGAGGAAAAGAGACCCAAGTTCGTCGAGCTAAGGTCGTCA
AAATGGTTTATTATGTTCGTCGTGGCCTTTGCTACCGGGACGGACATCTTCATGTACGGTCTTATCGTACCGGTC
ACGCCAACAGCATTGAAAGACAAAGTGGGAATCTCAGAGGATGATGTCCAAAGCTGGACATCCATTCTCCTTGCC
CTGTACTCGGCTGCTTTGTTAGCCTTTGCCCCTGTTGTCGGGTACATTGCTGACCGAGCCGAGTCCCGTCGATGG
CCTTTGCTGTTTGGTCTCGTTGCGTTGGCCGCTGCAACAGCCTTACTGTGTGTCGGTACCAATATCGCGTTGTGG
ATTGTTGGTCGCTTGTTTCAAGGCGCTGCCGCTGCGGTGGTATGGACGGCCGGCCTGGCACTGATAGTAGACACT
ATCGGAAAAGACGACCTTGGCCAAGCCATTGGCTATGTCTCCATGGCTATCAGCATCGGAACGCTAGCTGGACCT
CTTCTCGGTGGCGTTGTCTACGAGAATGGTGGTTATTATGCCGTTTTCGGTCTTGCTTTCGGTTTCATCGCCCTC
GATATCATCTTACGATTGCTGTTGATCGAGAAAAGACATGCTATTAAATGGCTTGCGCCGGAGATGACACCGCTG
TCCGTGACGGAGAAGAAGTCAGGGGAAGTTTTAGAACATCCCGTCTTGCCAACCAATGGCTCTGAATCCCGTGAA
TCACAACCGCCTTCTCCCCCCTCACGGAGCGCGTTCGGACGTGTCGCTATTTTGTTGAGCTCACCCCGTCTCGTC
GTATCCGTCTGGGGATACTTTATCTTGTCAATCGTCCTGACCTCATTCGACAGTGTCCTTCCACTCTTCGTGCAA
GAGACATTCAAGTGGCAGCAAAGTGGCCAGGGACTAATCTTCATCTCGCTCATGGTGCCGCACGTCTTAGACCCA
CTGATGGGGTTTGTTATTGACAAGTACCCCAAATCCTGTCGCTACCTCGCTGCAGGCGCATTTCTCACCGTCGTT
CCCGTTCTGGTGCTTCTGCGTTTTGTCAAGGACAACTCGATGCAGCACAAGATTCTATTGTGTGCCCTCCTCGCT
TGTGTTGGGGTATGCTTTGCGGTGGCTATGCCACCTCTCATTGTGGAGGTGTTCTTCGCTGTGAAGGAGAAGGAA
GATAAAACTCCTGATATCTTCGGTCGCGGTGGCGCTATGGCTCTGGCTTTTGGGCTGTCGAATATGGGGTTCGCG
ACCGGGAGTCTGATCGGCCCATTCTTTGCGGGTTATATTCGCCAGGAAGCTGGCTGGGGTGCGATGGGTTGGGCA
TTGGGGTTGATAGTGGGCGTATCATCTCTCCCAATCCTGTTGTTCGTGGGTGGCTGGATCTTGAAAAAGCCGCTC
GAGTCAGACACTGAAGGCCAGTTGATGGACAGCGCCCCTGTCCCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail