Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7366.t1
Gene name
Locationscaffold_22:356626..357431
Strand-
Gene length (bp)805
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07426 Dynactin_p22 Dynactin subunit p22 1.6E-09 13 174

GO

GO Term Description Terminal node
GO:0005869 dynactin complex Yes
GO:0061640 cytoskeleton-dependent cytokinesis Yes
GO:0005875 microtubule associated complex No
GO:0022402 cell cycle process No
GO:0008150 biological_process No
GO:0032991 protein-containing complex No
GO:0009987 cellular process No
GO:0000910 cytokinesis No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 19.66 7.11 32.21
5d_25C Five days - 25 degrees Celsius 20.24 7.39 33.10
7d_25C Seven days - 25 degrees Celsius 21.40 7.98 34.82
10d_25C Ten days - 25 degrees Celsius 18.70 6.12 31.29
7d_15C Seven days - 15 degrees Celsius 18.12 5.42 30.82
7d_30C Seven days - 30 degrees Celsius 26.54 10.32 42.76

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.960357 no
3d_25C 7d_25C 0.872428 no
3d_25C 7d_15C 0.879353 no
3d_25C 7d_30C 0.456889 no
3d_25C 10d_25C 0.928910 no
5d_25C 7d_25C 0.919782 no
5d_25C 7d_15C 0.829979 no
5d_25C 7d_30C 0.508520 no
5d_25C 10d_25C 0.880374 no
7d_25C 7d_15C 0.733456 no
7d_25C 7d_30C 0.622868 no
7d_25C 10d_25C 0.785191 no
7d_15C 7d_30C 0.334475 no
7d_15C 10d_25C 0.958180 no
7d_30C 10d_25C 0.360121 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7366.t1
MALESDALAGATIELLEARLRRLAYLLTGATDWTGVPTTPEKPASLDETVSRRLVRLESELERLSRRVPAVRDVL
QLHDRNPDLFQTTPPHQIPEGLTNQTLASIVLSYATAFPETASRLTSLNDLPVPDAQSSAALIDLQPQLDRLAQT
QSEQAAEISELRVRTARVLQRWYEVGLVGSGECWAEWEGRLEDVEREVRRKEVVRQGREEEI*
Coding >Pro_DTO377G3_2|g7366.t1
ATGGCCCTCGAAAGTGATGCACTGGCCGGAGCCACCATCGAACTCCTCGAGGCGCGCCTACGCCGCCTCGCCTAC
CTCCTCACCGGCGCCACAGACTGGACCGGCGTCCCTACCACGCCCGAAAAGCCCGCATCTCTCGACGAGACAGTC
TCCCGCCGACTCGTACGGCTAGAATCAGAATTAGAACGGCTTAGTCGAAGGGTCCCAGCCGTACGAGACGTTCTA
CAACTCCACGACCGCAACCCAGATCTCTTCCAAACAACACCACCTCACCAAATCCCCGAAGGCCTCACAAACCAA
ACCCTAGCCTCAATAGTCCTCTCCTACGCCACCGCCTTCCCCGAAACCGCCTCGCGCCTTACATCGCTAAATGAC
CTCCCCGTGCCGGACGCGCAGAGCTCCGCAGCACTAATCGACCTACAGCCACAGTTAGACAGGCTCGCGCAGACA
CAGAGTGAGCAGGCTGCTGAGATCTCGGAGCTGCGGGTGCGCACAGCGCGCGTGCTGCAGCGCTGGTATGAGGTT
GGGCTCGTTGGGAGTGGGGAGTGCTGGGCTGAATGGGAGGGGAGACTTGAGGATGTTGAGAGGGAGGTTAGGAGG
AAAGAGGTTGTTAGGCAGGGCAGGGAGGAGGAAATTTAG
Transcript >Pro_DTO377G3_2|g7366.t1
ATGGCCCTCGAAAGTGATGCACTGGCCGGAGCCACCATCGAACTCCTCGAGGCGCGCCTACGCCGCCTCGCCTAC
CTCCTCACCGGCGCCACAGACTGGACCGGCGTCCCTACCACGCCCGAAAAGCCCGCATCTCTCGACGAGACAGTC
TCCCGCCGACTCGTACGGCTAGAATCAGAATTAGAACGGCTTAGTCGAAGGGTCCCAGCCGTACGAGACGTTCTA
CAACTCCACGACCGCAACCCAGATCTCTTCCAAACAACACCACCTCACCAAATCCCCGAAGGCCTCACAAACCAA
ACCCTAGCCTCAATAGTCCTCTCCTACGCCACCGCCTTCCCCGAAACCGCCTCGCGCCTTACATCGCTAAATGAC
CTCCCCGTGCCGGACGCGCAGAGCTCCGCAGCACTAATCGACCTACAGCCACAGTTAGACAGGCTCGCGCAGACA
CAGAGTGAGCAGGCTGCTGAGATCTCGGAGCTGCGGGTGCGCACAGCGCGCGTGCTGCAGCGCTGGTATGAGGTT
GGGCTCGTTGGGAGTGGGGAGTGCTGGGCTGAATGGGAGGGGAGACTTGAGGATGTTGAGAGGGAGGTTAGGAGG
AAAGAGGTTGTTAGGCAGGGCAGGGAGGAGGAAATTTAG
Gene >Pro_DTO377G3_2|g7366.t1
ATGGCCCTCGAAAGTGATGCACTGGCCGGAGCCACCATCGAACTCCTCGAGGCGCGCCTACGCCGCCTCGCCTAC
CTCCTCACCGGCGCCACAGACTGGACCGGCGTCCCTACCACGCCCGAAAAGCCCGCATCTCTCGACGAGACAGTC
TCCCGCCGACTCGTACGGCTAGAATCAGAATTAGAACGGCTTAGTCGAAGGGTCCCAGCCGTACGAGACGTTCTA
CAACTCCGTATGTCACCGACCAGTGTTAATGTTATTTACACGCGCTTCACCACTACACCGTCCCCTCATCTCATA
CCCTTCTCGCTATTTGAATTGCATTTCTGATACCTGGATAATGGATTCTGAAATATCCACTCCAAACCATCCAAT
TCATACTAACACAAACCACCTAGACGACCGCAACCCAGATCTCTTCCAAACAACACCACCTCACCAAATCCCCGA
AGGCCTCACAAACCAAACCCTAGCCTCAATAGTCCTCTCCTACGCCACCGCCTTCCCCGAAACCGCCTCGCGCCT
TACATCGCTAAATGACCTCCCCGTGCCGGACGCGCAGAGCTCCGCAGCACTAATCGACCTACAGCCACAGTTAGA
CAGGCTCGCGCAGACACAGAGTGAGCAGGCTGCTGAGATCTCGGAGCTGCGGGTGCGCACAGCGCGCGTGCTGCA
GCGCTGGTATGAGGTTGGGCTCGTTGGGAGTGGGGAGTGCTGGGCTGAATGGGAGGGGAGACTTGAGGATGTTGA
GAGGGAGGTTAGGAGGAAAGAGGTTGTTAGGCAGGGCAGGGAGGAGGAAATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail