Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7365.t1
Gene name
Locationscaffold_22:352927..355317
Strand-
Gene length (bp)2390
Transcript length (bp)1137
Coding sequence length (bp)1137
Protein length (aa) 379

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00018 SH3_1 SH3 domain 3.5E-08 325 372
PF07653 SH3_2 Variant SH3 domain 3.9E-05 325 375

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 101 123 22
2 130 152 22
3 162 184 22
4 191 213 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7365.t1
MSLGSRATLKSLRLWVPSFGSQPLHPHGLSLNPLRFQVTPSRPPRLGPNNQQQLLYTKHVAHRHSLVFFARLISI
PFTQAQSNKSAKMGKFRPSNILGDPFALMTVSISILAWLIALIASIIADLKTEYPNYSWWAISYMFCVIVGLVTT
FATDTGHVYGMAIVGYLACGLVLTSTSANNLIYGNQPSMQAAGAGFILLSMMIIVWIFYFGSTPQATHRGFIDSF
ALNKEQPAEPSYRGSRPMSSAFGARPDTMATSNTPQMYTSAQLGGFETSSPVSGYPGGAPGAERTSSAPRFGTPN
PQTPGNGEQEVGEVPQPTDYPYRAKAIYSYDANPEDANEISFAKHEILEVSDVSGRWWQARKQNGDTGIAPSNYL
ILL*
Coding >Pro_DTO377G3_2|g7365.t1
ATGAGCCTTGGATCACGAGCAACTCTTAAGAGTCTTAGGCTTTGGGTCCCTTCTTTCGGTTCCCAACCTCTTCAT
CCCCACGGATTGTCTCTGAATCCACTTCGGTTTCAAGTCACTCCTTCCCGTCCGCCTCGTTTAGGACCCAACAAT
CAACAACAACTCTTATATACAAAGCACGTCGCTCATCGCCATTCCCTCGTTTTCTTCGCCCGTCTCATATCAATT
CCCTTTACACAAGCCCAATCCAATAAATCCGCCAAAATGGGCAAATTCCGGCCTAGCAACATCCTAGGCGATCCG
TTCGCGCTCATGACCGTCTCGATTTCAATTCTGGCATGGCTTATTGCTCTCATCGCATCTATCATCGCCGATTTG
AAAACCGAATATCCTAACTACTCATGGTGGGCCATCTCATACATGTTCTGTGTTATTGTGGGCCTCGTCACGACC
TTTGCCACGGACACAGGCCACGTTTATGGCATGGCGATCGTCGGTTACCTCGCCTGTGGCCTCGTCCTAACATCT
ACGAGCGCAAACAACCTGATCTACGGAAACCAACCATCCATGCAAGCCGCTGGCGCAGGCTTCATCCTGCTTTCC
ATGATGATCATCGTCTGGATCTTCTACTTCGGCTCCACACCGCAGGCCACTCACCGCGGCTTCATCGACTCCTTC
GCCCTGAACAAGGAACAGCCCGCCGAGCCCTCCTACCGCGGTAGTCGCCCCATGTCCAGCGCATTCGGCGCCCGC
CCAGATACCATGGCAACCAGCAATACCCCGCAGATGTACACCTCCGCCCAACTTGGCGGCTTCGAGACCTCGTCC
CCTGTCTCCGGGTACCCTGGCGGTGCGCCCGGCGCCGAACGAACCTCCTCTGCGCCTCGATTCGGTACCCCCAAC
CCTCAGACTCCCGGTAACGGCGAGCAAGAAGTGGGCGAAGTGCCTCAGCCAACAGACTACCCCTACCGCGCCAAG
GCTATCTACTCATATGACGCCAACCCGGAAGACGCCAACGAAATCAGCTTCGCCAAGCACGAGATCTTGGAAGTA
TCTGATGTGAGCGGCCGATGGTGGCAGGCTCGGAAGCAAAATGGAGATACAGGCATTGCGCCCTCGAACTATTTG
ATCCTTCTGTGA
Transcript >Pro_DTO377G3_2|g7365.t1
ATGAGCCTTGGATCACGAGCAACTCTTAAGAGTCTTAGGCTTTGGGTCCCTTCTTTCGGTTCCCAACCTCTTCAT
CCCCACGGATTGTCTCTGAATCCACTTCGGTTTCAAGTCACTCCTTCCCGTCCGCCTCGTTTAGGACCCAACAAT
CAACAACAACTCTTATATACAAAGCACGTCGCTCATCGCCATTCCCTCGTTTTCTTCGCCCGTCTCATATCAATT
CCCTTTACACAAGCCCAATCCAATAAATCCGCCAAAATGGGCAAATTCCGGCCTAGCAACATCCTAGGCGATCCG
TTCGCGCTCATGACCGTCTCGATTTCAATTCTGGCATGGCTTATTGCTCTCATCGCATCTATCATCGCCGATTTG
AAAACCGAATATCCTAACTACTCATGGTGGGCCATCTCATACATGTTCTGTGTTATTGTGGGCCTCGTCACGACC
TTTGCCACGGACACAGGCCACGTTTATGGCATGGCGATCGTCGGTTACCTCGCCTGTGGCCTCGTCCTAACATCT
ACGAGCGCAAACAACCTGATCTACGGAAACCAACCATCCATGCAAGCCGCTGGCGCAGGCTTCATCCTGCTTTCC
ATGATGATCATCGTCTGGATCTTCTACTTCGGCTCCACACCGCAGGCCACTCACCGCGGCTTCATCGACTCCTTC
GCCCTGAACAAGGAACAGCCCGCCGAGCCCTCCTACCGCGGTAGTCGCCCCATGTCCAGCGCATTCGGCGCCCGC
CCAGATACCATGGCAACCAGCAATACCCCGCAGATGTACACCTCCGCCCAACTTGGCGGCTTCGAGACCTCGTCC
CCTGTCTCCGGGTACCCTGGCGGTGCGCCCGGCGCCGAACGAACCTCCTCTGCGCCTCGATTCGGTACCCCCAAC
CCTCAGACTCCCGGTAACGGCGAGCAAGAAGTGGGCGAAGTGCCTCAGCCAACAGACTACCCCTACCGCGCCAAG
GCTATCTACTCATATGACGCCAACCCGGAAGACGCCAACGAAATCAGCTTCGCCAAGCACGAGATCTTGGAAGTA
TCTGATGTGAGCGGCCGATGGTGGCAGGCTCGGAAGCAAAATGGAGATACAGGCATTGCGCCCTCGAACTATTTG
ATCCTTCTGTGA
Gene >Pro_DTO377G3_2|g7365.t1
ATGAGCCTTGGATCACGAGCAACTCTTAAGAGTCTTAGGCTTTGTCCCCTGGGCCCTGGATAAACTTCTAAGCCT
CTTTTCTACCTTAAACCTACTTTTTATTGATACAATGGACTCTATTTTATCTAGGATCCATGGTTCATCTAGGCT
GAGCAAGAATTTGTCGTAAGCTCGCGACTTTTAGGGTGGTATTTGATAGTTATGATCCTTCGGATTTGGTATTCA
TTCTTAAGGTTTGTCCCGATTCGGAAAAGAACGCGAGTGTGGTACCAACAACACACTCCTTACAGTATACTTATT
ATCTGTTATGTACTACGGGCAGACATCTGTAGATTTGGTGTAGGTATAGATTAGATAGTATAATCATCCATATGT
CTAACACGTGCTGATCAGATGCGATCAACGCGGACTCGGTATGTATGTACTTGTACGGAGTATAGTTAGTATTCG
AAATTTCATGAGTATAGAAACCAAAATGGTCCGGGCAATTCTTCACAGAAAAACAAGATGAGGCTGACCCGTCTT
GACCACCTTGCGAACTGAAGTCGCTGTATAATGTGTTAGTTGTTATCCTATAAGACCGAAAATGTTCTATAGGGA
CTTACGAAATATTTCTGACACTTCAGATGTCCCGAATTATAGTCATAAAAGTCATAGCATGGCCGTGCACAAAGC
GGAGGTGACTAAGATATTTAGGGATATTTATAGATTTGTACCAGATCAAGTCTATTTTCATTGTTTTATAATTAG
CGATGAATCAAAAGAGATAAAGTAATTCAAACGACCAAGGTAATTGTCATGTACCTTATAAGATTATAATCCCGC
CAAGTCAACTTGTTCCCTTGAAATTTCTTAATTTCCTTAATTTCAAGAATCGAGACCGTCGATTTCCAGGGGGGA
CCCGGACTCCACAGCGTATCTGCCACTTTTCCTCCTTTTCCATCATTCTCCTCTCTCTCCTCTCTTTCAACCTTC
AATCTTATCCACTCTTTTATCTTCATTGATTCCCTCTCTCATTTCTTTCATTTTATCCCAGCCTGGTGCTGGTTT
TGCCTCTCTGTAAGGGGTCCCTTCTTTCGGTTCCCAACCTCTTCATCCCCACGGATTGTCTCTGAATCCACTTCG
GTTTCAAGGTACTTTAATCCTATATCTGCCTACTCCATATGATGTCGGGCTTCCTTTATAAACTGTCGCATTCAT
AATTCATTGCCACATCCCATGCAATCACGCCTGTCGTTCCCACACTAACTAACCACAGTCACTCCTTCCCGTCCG
CCTCGTTTAGGACCCAACAATCAACAACAACTCTTATATACAAAGCACGTCGCTCATCGCCATTCCCTCGTTTTC
TTCGCCCGTCTCATATCAATTCCCTTTACACAAGCCCAATCCAATAAATCCGCCAAAATGGGCAAATTCCGGCCT
AGCAACATCCTAGGCGATCCGTTCGCGCTCATGACCGTCTCGATTTCAATTGTTCGTTCGACTTTCTCTATGACC
CGATATTGACTAACATACAGTTCTAGCTGGCATGGCTTATTGCTCTCATCGCATCTATCATCGCCGATTTGAAAA
CCGAATATCCTAACTACTCATGGTGGGCCATCTCATACATGTTCTGTGTTATTGTGGGCCTCGTCACGACCTTTG
CCACGGACACAGGCCACGTTTATGGCATGGCGGTATGATGACTCTTGAATACAGATAACACGAGCCTCCAGTACT
GACAATATCTCCAGATCGTCGGTTACCTCGCCTGTGGCCTCGTCCTAACATCTACGAGCGCAAACAACCTGATCT
ACGGAAACCAACCATCCATGCAAGCCGCTGGCGCAGGCTTCATCCTGCTTTCCATGATGATCATCGTCTGGATCT
TCTACTTCGGCTCCACACCGCAGGCCACTCACCGCGGCTTCATCGACTCCTTCGCCCTGAACAAGGAACAGCCCG
CCGAGCCCTCCTACCGCGGTAGTCGCCCCATGTCCAGCGCATTCGGCGCCCGCCCAGATACCATGGCAACCAGCA
ATACCCCGCAGATGTACACCTCCGCCCAACTTGGCGGCTTCGAGACCTCGTCCCCTGTCTCCGGGTACCCTGGCG
GTGCGCCCGGCGCCGAACGAACCTCCTCTGCGCCTCGATTCGGTACCCCCAACCCTCAGACTCCCGGTAACGGCG
AGCAAGAAGTGGGCGAAGTGCCTCAGCCAACAGACTACCCCTACCGCGCCAAGGCTATCTACTCATATGACGCCA
ACCCGGAAGACGCCAACGAAATCAGCTTCGCCAAGCACGAGATCTTGGAAGTATCTGATGTGAGCGGCCGATGGT
GGCAGGCTCGGAAGCAAAATGGAGATACAGGCATTGCGCCCTCGAACTATTTGATCCTTCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail