Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7364.t1
Gene name
Locationscaffold_22:347260..350073
Strand+
Gene length (bp)2813
Transcript length (bp)2709
Coding sequence length (bp)2709
Protein length (aa) 903

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 1.1E-91 410 681
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 8.7E-43 28 178
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 1.8E-34 201 397
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 1.2E-31 802 894

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 27 49 22
2 106 128 22
3 154 176 22
4 414 436 22
5 460 482 22
6 503 525 22
7 553 575 22
8 596 618 22
9 623 645 22
10 666 685 19
11 690 712 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7364.t1
MAHDAVHWLAARDTSDDPQDTTPTLSGLLTTLIPALVSFVVMVLLFIILRKSNRRMYMPRTYIGYLRPWQRTPDS
PTGSWNWIKAMYQLPDTYVLQHHSMDAYLMLRFLKLCSVMLFVGCCITFPILWPVNATGGGGKIQLNLLSISNID
ETQYGRYYAHCFLAWIYVSFIFFMITREHLFYINLRQAYLFSPANASRISSRTVLFTAVTQDLLNKEKLRTMFGR
DKVKNVWIATDTKELEEKVKDRDAAAMKLEGAETKLIVLANKTRSKALKKKGSAENPETDIGDGQFDDESGSVAA
RWVEAKKRPTHRLTMLIGKKVDTINWARSEIERLSPEIEELQAQHRAGETKLVSSVFVEFYHQSDAQSSFQSVAH
NLPLHMSPRYIGLDPTQVIWSNLRIKWWERLGRYAATMSFVCAMIIFWAIPTAVVGAISNIDSLTKIVPFLKFID
SVPSWIKGVITGLLPTVMMAVLLALVPIILRLMAKFGGAPSLPAVELTVQNWFFAFQVVQVFLVVTVASSATSVV
SSIIDKPSSAASLLAQKIPTASNFYISYIILQGLSFSAGALLQIVGLILGKILGRLLDSTPRKMYTRWSSLAGLG
WGTVYPAFTLLTVVAIVYSCIAPLVMGFGTIGLYLFYFAYRYNLLYVSNSTIDTQGRCYTRALQQLTVGCYLSMV
CLIGLFAIGTGANTMALGPLILMIIFLIFVILFHLSMNSAMEPLLNYLPKNLEAEEEGLLAAEKANISTLNENSK
TDDMSGPGGSISASRDSGVANVDNSLGSVDSAEKGLTEKSPPAPKPNFLTKFLRPDLYHNYHQLRKLVPSSSEIP
TYPAEVERDAYCHPAVSSHPPLLWIPRDPLGVSAQEVAHTSRVIPITDEDAYLDENCKIQWNEEKGEPPIYEEKV
TY*
Coding >Pro_DTO377G3_2|g7364.t1
ATGGCCCACGATGCCGTGCACTGGCTGGCCGCCAGGGATACGAGCGACGACCCGCAGGACACCACGCCGACACTA
TCTGGTCTGCTCACCACCCTAATCCCTGCTCTCGTCTCCTTCGTTGTGATGGTGTTGCTCTTCATCATCCTGCGC
AAGAGCAATCGCAGGATGTACATGCCGCGAACCTACATTGGATACCTCCGTCCCTGGCAGCGCACCCCCGATTCT
CCAACCGGATCCTGGAACTGGATCAAGGCGATGTACCAGTTACCCGACACCTACGTCTTGCAGCATCACTCGATG
GACGCCTACCTCATGCTTCGCTTCCTCAAACTGTGCTCCGTGATGTTGTTCGTGGGCTGCTGTATCACTTTCCCG
ATCTTGTGGCCCGTCAATGCCACAGGCGGTGGTGGAAAGATCCAACTGAACCTTCTGAGCATCTCAAATATCGAC
GAGACTCAATACGGTCGTTACTATGCGCATTGCTTCCTCGCCTGGATCTATGTCTCCTTCATCTTCTTCATGATA
ACTCGCGAGCACCTATTTTATATCAACCTCCGCCAGGCGTACCTGTTCTCACCCGCCAACGCGAGCCGCATCTCG
TCTCGCACCGTTTTGTTCACAGCCGTTACCCAGGACCTCCTGAATAAGGAAAAGCTTCGCACCATGTTTGGCCGC
GACAAGGTCAAGAATGTCTGGATCGCAACCGATACCAAGGAGCTCGAGGAGAAGGTCAAGGACCGCGATGCTGCT
GCGATGAAGCTCGAGGGTGCGGAGACCAAGCTCATTGTGCTTGCTAATAAGACGCGCAGCAAGGCTCTTAAGAAG
AAAGGCTCGGCCGAGAACCCCGAGACTGACATTGGCGATGGCCAGTTTGATGATGAGTCTGGCTCCGTCGCTGCT
CGTTGGGTGGAGGCTAAGAAACGACCCACACACCGTCTCACGATGCTTATTGGCAAGAAGGTCGACACTATCAAT
TGGGCGCGTTCGGAAATCGAGCGTCTCTCTCCCGAAATCGAGGAGTTGCAGGCCCAGCACCGTGCTGGAGAAACC
AAGCTGGTCTCCTCCGTTTTTGTCGAGTTCTACCATCAGTCTGATGCTCAGTCTTCCTTCCAGTCTGTGGCTCAC
AACCTCCCCCTGCACATGAGCCCTCGTTACATTGGTTTAGACCCTACTCAGGTCATCTGGTCCAACCTGCGCATC
AAGTGGTGGGAACGCCTCGGTCGCTACGCTGCCACCATGAGCTTTGTTTGTGCTATGATCATCTTCTGGGCTATC
CCTACTGCAGTTGTTGGTGCCATCTCCAACATTGACTCTTTGACCAAGATCGTTCCTTTCCTGAAGTTCATTGAC
AGCGTTCCGTCATGGATTAAGGGTGTTATTACCGGTCTCTTGCCCACTGTCATGATGGCAGTCCTTCTGGCGCTG
GTGCCTATCATCCTTCGCCTGATGGCTAAGTTCGGGGGTGCACCTAGTCTACCAGCTGTTGAACTGACCGTCCAA
AACTGGTTCTTCGCATTTCAAGTTGTTCAGGTCTTCCTAGTGGTGACCGTTGCCTCATCGGCCACCAGTGTCGTC
AGTAGTATCATTGACAAACCCTCGTCGGCCGCCTCGCTGCTAGCCCAGAAGATCCCCACCGCGTCCAACTTTTAC
ATCTCATATATCATTCTACAAGGATTGTCTTTCAGCGCCGGTGCTCTACTTCAGATTGTCGGCCTGATTCTGGGC
AAGATCCTCGGCAGATTACTGGATAGCACCCCTCGCAAGATGTACACGCGTTGGTCAAGCTTGGCTGGTCTCGGA
TGGGGCACTGTCTACCCTGCATTCACATTGTTGACTGTTGTCGCGATCGTCTACTCTTGCATTGCACCGCTTGTC
ATGGGCTTCGGTACCATTGGTCTATACCTCTTCTATTTCGCCTACCGGTACAACCTGTTGTACGTGTCGAACTCA
ACCATCGACACCCAGGGTAGATGCTACACCCGTGCTCTGCAGCAGCTCACTGTCGGCTGCTACCTGTCCATGGTT
TGCCTGATTGGTCTGTTCGCCATTGGCACCGGTGCCAATACGATGGCTCTCGGTCCCCTGATTCTGATGATCATC
TTCTTGATCTTCGTCATTCTATTCCATCTCTCTATGAACAGCGCCATGGAGCCCCTCCTAAACTACCTTCCCAAG
AACCTCGAGGCAGAGGAGGAGGGTCTGCTCGCCGCTGAGAAGGCCAACATCAGTACTCTGAACGAGAACTCCAAG
ACCGATGACATGTCCGGTCCCGGTGGCTCCATCTCGGCCTCCCGTGACAGTGGCGTCGCCAACGTGGACAACAGC
CTCGGCAGCGTCGACTCCGCCGAGAAGGGTCTCACCGAGAAGTCGCCGCCAGCGCCCAAGCCGAACTTTTTGACC
AAGTTCCTGCGTCCGGACCTGTACCATAACTACCACCAGCTGCGCAAGTTGGTTCCCAGCTCCTCGGAAATCCCT
ACTTACCCTGCTGAGGTCGAGCGTGACGCCTACTGCCACCCGGCCGTCAGCTCGCACCCCCCTCTTCTCTGGATT
CCCCGCGACCCTCTCGGAGTCAGCGCCCAAGAAGTCGCTCACACTTCTCGTGTCATTCCCATCACGGACGAGGAT
GCCTATCTCGATGAGAACTGCAAGATCCAATGGAACGAGGAGAAGGGAGAGCCCCCCATCTACGAGGAGAAGGTT
ACCTACTAA
Transcript >Pro_DTO377G3_2|g7364.t1
ATGGCCCACGATGCCGTGCACTGGCTGGCCGCCAGGGATACGAGCGACGACCCGCAGGACACCACGCCGACACTA
TCTGGTCTGCTCACCACCCTAATCCCTGCTCTCGTCTCCTTCGTTGTGATGGTGTTGCTCTTCATCATCCTGCGC
AAGAGCAATCGCAGGATGTACATGCCGCGAACCTACATTGGATACCTCCGTCCCTGGCAGCGCACCCCCGATTCT
CCAACCGGATCCTGGAACTGGATCAAGGCGATGTACCAGTTACCCGACACCTACGTCTTGCAGCATCACTCGATG
GACGCCTACCTCATGCTTCGCTTCCTCAAACTGTGCTCCGTGATGTTGTTCGTGGGCTGCTGTATCACTTTCCCG
ATCTTGTGGCCCGTCAATGCCACAGGCGGTGGTGGAAAGATCCAACTGAACCTTCTGAGCATCTCAAATATCGAC
GAGACTCAATACGGTCGTTACTATGCGCATTGCTTCCTCGCCTGGATCTATGTCTCCTTCATCTTCTTCATGATA
ACTCGCGAGCACCTATTTTATATCAACCTCCGCCAGGCGTACCTGTTCTCACCCGCCAACGCGAGCCGCATCTCG
TCTCGCACCGTTTTGTTCACAGCCGTTACCCAGGACCTCCTGAATAAGGAAAAGCTTCGCACCATGTTTGGCCGC
GACAAGGTCAAGAATGTCTGGATCGCAACCGATACCAAGGAGCTCGAGGAGAAGGTCAAGGACCGCGATGCTGCT
GCGATGAAGCTCGAGGGTGCGGAGACCAAGCTCATTGTGCTTGCTAATAAGACGCGCAGCAAGGCTCTTAAGAAG
AAAGGCTCGGCCGAGAACCCCGAGACTGACATTGGCGATGGCCAGTTTGATGATGAGTCTGGCTCCGTCGCTGCT
CGTTGGGTGGAGGCTAAGAAACGACCCACACACCGTCTCACGATGCTTATTGGCAAGAAGGTCGACACTATCAAT
TGGGCGCGTTCGGAAATCGAGCGTCTCTCTCCCGAAATCGAGGAGTTGCAGGCCCAGCACCGTGCTGGAGAAACC
AAGCTGGTCTCCTCCGTTTTTGTCGAGTTCTACCATCAGTCTGATGCTCAGTCTTCCTTCCAGTCTGTGGCTCAC
AACCTCCCCCTGCACATGAGCCCTCGTTACATTGGTTTAGACCCTACTCAGGTCATCTGGTCCAACCTGCGCATC
AAGTGGTGGGAACGCCTCGGTCGCTACGCTGCCACCATGAGCTTTGTTTGTGCTATGATCATCTTCTGGGCTATC
CCTACTGCAGTTGTTGGTGCCATCTCCAACATTGACTCTTTGACCAAGATCGTTCCTTTCCTGAAGTTCATTGAC
AGCGTTCCGTCATGGATTAAGGGTGTTATTACCGGTCTCTTGCCCACTGTCATGATGGCAGTCCTTCTGGCGCTG
GTGCCTATCATCCTTCGCCTGATGGCTAAGTTCGGGGGTGCACCTAGTCTACCAGCTGTTGAACTGACCGTCCAA
AACTGGTTCTTCGCATTTCAAGTTGTTCAGGTCTTCCTAGTGGTGACCGTTGCCTCATCGGCCACCAGTGTCGTC
AGTAGTATCATTGACAAACCCTCGTCGGCCGCCTCGCTGCTAGCCCAGAAGATCCCCACCGCGTCCAACTTTTAC
ATCTCATATATCATTCTACAAGGATTGTCTTTCAGCGCCGGTGCTCTACTTCAGATTGTCGGCCTGATTCTGGGC
AAGATCCTCGGCAGATTACTGGATAGCACCCCTCGCAAGATGTACACGCGTTGGTCAAGCTTGGCTGGTCTCGGA
TGGGGCACTGTCTACCCTGCATTCACATTGTTGACTGTTGTCGCGATCGTCTACTCTTGCATTGCACCGCTTGTC
ATGGGCTTCGGTACCATTGGTCTATACCTCTTCTATTTCGCCTACCGGTACAACCTGTTGTACGTGTCGAACTCA
ACCATCGACACCCAGGGTAGATGCTACACCCGTGCTCTGCAGCAGCTCACTGTCGGCTGCTACCTGTCCATGGTT
TGCCTGATTGGTCTGTTCGCCATTGGCACCGGTGCCAATACGATGGCTCTCGGTCCCCTGATTCTGATGATCATC
TTCTTGATCTTCGTCATTCTATTCCATCTCTCTATGAACAGCGCCATGGAGCCCCTCCTAAACTACCTTCCCAAG
AACCTCGAGGCAGAGGAGGAGGGTCTGCTCGCCGCTGAGAAGGCCAACATCAGTACTCTGAACGAGAACTCCAAG
ACCGATGACATGTCCGGTCCCGGTGGCTCCATCTCGGCCTCCCGTGACAGTGGCGTCGCCAACGTGGACAACAGC
CTCGGCAGCGTCGACTCCGCCGAGAAGGGTCTCACCGAGAAGTCGCCGCCAGCGCCCAAGCCGAACTTTTTGACC
AAGTTCCTGCGTCCGGACCTGTACCATAACTACCACCAGCTGCGCAAGTTGGTTCCCAGCTCCTCGGAAATCCCT
ACTTACCCTGCTGAGGTCGAGCGTGACGCCTACTGCCACCCGGCCGTCAGCTCGCACCCCCCTCTTCTCTGGATT
CCCCGCGACCCTCTCGGAGTCAGCGCCCAAGAAGTCGCTCACACTTCTCGTGTCATTCCCATCACGGACGAGGAT
GCCTATCTCGATGAGAACTGCAAGATCCAATGGAACGAGGAGAAGGGAGAGCCCCCCATCTACGAGGAGAAGGTT
ACCTACTAA
Gene >Pro_DTO377G3_2|g7364.t1
ATGGCCCACGATGCCGTGCACTGGCTGGCCGCCAGGGATACGGTAAGCTCTGTCGAACACCTAGGTAGCCGGTCC
TTTACTCACGATACTAGAGCGACGACCCGCAGGACACCACGCCGACACTATCTGGTCTGCTCACCACCCTAATCC
CTGCTCTCGTCTCCTTCGTTGTGATGGTGTTGCTCTTCATCATCCTGCGCAAGAGCAATCGCAGGATGTACATGC
CGCGAACCTACATTGGATACCTCCGTCCCTGGCAGCGCACCCCCGATTCTCCAACCGGATCCTGGAACTGGATCA
AGGCGATGTACCAGTTACCCGACACCTACGTCTTGCAGCATCACTCGATGGACGCCTACCTCATGCTTCGCTTCC
TCAAACTGTGCTCCGTGATGTTGTTCGTGGGCTGCTGTATCACTTTCCCGATCTTGTGGCCCGTCAATGCCACAG
GCGGTGGTGGAAAGATCCAACTGAACCTTCTGAGCATCTCAAATATCGACGAGACTCAATACGGTCGTTACTATG
CGCATTGCTTCCTCGCCTGGATCTATGTCTCCTTCATCTTCTTCATGATAACTCGCGAGCACCTATTTTATATCA
ACCTCCGCCAGGCGTACCTGTTCTCACCCGCCAACGCGAGCCGCATCTCGTCTCGCACCGTTTTGTTCACAGCCG
TTACCCAGGACCTCCTGAATAAGGAAAAGCTTCGCACCATGTTTGGCCGCGACAAGGTCAAGAATGTCTGGATCG
CAACCGATACCAAGGAGCTCGAGGAGAAGGTCAAGGACCGCGATGCTGCTGCGATGAAGCTCGAGGGTGCGGAGA
CCAAGCTCATTGTGCTTGCTAATAAGACGCGCAGCAAGGCTCTTAAGAAGAAAGGCTCGGCCGAGAACCCCGAGA
CTGACATTGGCGATGGCCAGTTTGATGATGAGTCTGGCTCCGTCGCTGCTCGTTGGGTGGAGGCTAAGAAACGAC
CCACACACCGTCTCACGATGCTTATTGGCAAGAAGGTCGACACTATCAATTGGGCGCGTTCGGAAATCGAGCGTC
TCTCTCCCGAAATCGAGGAGTTGCAGGCCCAGCACCGTGCTGGAGAAACCAAGCTGGTCTCCTCCGTTTTTGTCG
AGTTCTACCATCAGTCTGATGCTCAGTCTTCCTTCCAGTCTGTGGCTCACAACCTCCCCCTGCACATGAGCCCTC
GTTACATTGGTTTAGACCCTACTCAGGTCATCTGGTCCAACCTGCGCATCAAGTGGTGGGAACGCCTCGGTCGCT
ACGCTGCCACCATGAGCTTTGTTTGTGCTATGATCATCTTCTGGGCTATCCCTACTGCAGTTGTTGGTGCCATCT
CCAACATTGACTCTTTGACCAAGATCGTTCCTTTCCTGAAGTTCATTGACAGCGTTCCGTCATGGATTAAGGGTG
TTATTACCGGTCTCTTGCCCACTGTCATGATGGCAGTCCTTCTGGCGCTGGTGCCTATCATCCTTCGCCTGATGG
CTAAGTTCGGGGGTGCACCTAGTCTACCAGCTGTTGAACTGACCGTCCAAAACTGGTTCTTCGCATTTCAAGTTG
TTCAGGTCTTCCTAGTGGTGACCGTTGCCTCATCGGCCACCAGTGTCGTCAGTAGTATCATTGACAAACCCTCGT
CGGCCGCCTCGCTGCTAGCCCAGAAGATCCCCACCGCGTCCAACTTTTACATCTCATATATCATTCTACAAGGAT
TGTCTTTCAGCGCCGGTGCTCTACTTCAGATTGTCGGCCTGATTCTGGGCAAGATCCTCGGCAGATTACTGGATA
GCACCCCTCGCAAGATGTACACGCGTTGGTCAAGCTTGGCTGGTCTCGGATGGGGCACTGTCTACCCTGCATTCA
CATTGTTGACTGTTGTCGGTATGTTACACGAGTGATCGATTTATTTGTTTATGACACTAACGTTTCTCTTAGCGA
TCGTCTACTCTTGCATTGCACCGCTTGTCATGGGCTTCGGTACCATTGGTCTATACCTCTTCTATTTCGCCTACC
GGTACAACCTGTTGTACGTGTCGAACTCAACCATCGACACCCAGGGTAGATGCTACACCCGTGCTCTGCAGCAGC
TCACTGTCGGCTGCTACCTGTCCATGGTTTGCCTGATTGGTCTGTTCGCCATTGGCACCGGTGCCAATACGATGG
CTCTCGGTCCCCTGATTCTGATGATCATCTTCTTGATCTTCGTCATTCTATTCCATCTCTCTATGAACAGCGCCA
TGGAGCCCCTCCTAAACTACCTTCCCAAGAACCTCGAGGCAGAGGAGGAGGGTCTGCTCGCCGCTGAGAAGGCCA
ACATCAGTACTCTGAACGAGAACTCCAAGACCGATGACATGTCCGGTCCCGGTGGCTCCATCTCGGCCTCCCGTG
ACAGTGGCGTCGCCAACGTGGACAACAGCCTCGGCAGCGTCGACTCCGCCGAGAAGGGTCTCACCGAGAAGTCGC
CGCCAGCGCCCAAGCCGAACTTTTTGACCAAGTTCCTGCGTCCGGACCTGTACCATAACTACCACCAGCTGCGCA
AGTTGGTTCCCAGCTCCTCGGAAATCCCTACTTACCCTGCTGAGGTCGAGCGTGACGCCTACTGCCACCCGGCCG
TCAGCTCGCACCCCCCTCTTCTCTGGATTCCCCGCGACCCTCTCGGAGTCAGCGCCCAAGAAGTCGCTCACACTT
CTCGTGTCATTCCCATCACGGACGAGGATGCCTATCTCGATGAGAACTGCAAGATCCAATGGAACGAGGAGAAGG
GAGAGCCCCCCATCTACGAGGAGAAGGTTACCTACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail