Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7362.t1
Gene name
Locationscaffold_22:339594..342647
Strand-
Gene length (bp)3053
Transcript length (bp)2862
Coding sequence length (bp)2862
Protein length (aa) 954

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00493 MCM MCM P-loop domain 2.1E-96 465 689
PF17207 MCM_OB MCM OB domain 2.7E-39 231 359
PF18263 MCM6_C MCM6 C-terminal winged-helix domain 1.7E-30 844 950
PF17855 MCM_lid MCM AAA-lid domain 8.5E-24 703 790
PF14551 MCM_N MCM N-terminal domain 1.8E-17 82 224
PF01078 Mg_chelatase Magnesium chelatase, subunit ChlI 2.3E-04 573 671

GO

GO Term Description Terminal node
GO:0032508 DNA duplex unwinding Yes
GO:0005524 ATP binding Yes
GO:0003677 DNA binding Yes
GO:0000166 nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0051276 chromosome organization No
GO:0008150 biological_process No
GO:0017076 purine nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0071103 DNA conformation change No
GO:0030554 adenyl nucleotide binding No
GO:0003676 nucleic acid binding No
GO:0016043 cellular component organization No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0071840 cellular component organization or biogenesis No
GO:0003674 molecular_function No
GO:0032392 DNA geometric change No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0006996 organelle organization No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7362.t1
MSSLFDAVIQSELGSAPSRDRNLRSDNLPSSRRSESNGPMSDMNAFPDDQVVGAGSSAISRMRNPYAPAAPPVVD
EAAEKVQQAFEELLESYIDEPSSSAPPSSGEFLSDKYYIAQIKGMKKFELSTLYVDFTHIHNPVLADAIASQYYR
FQPFLTKGLHNLIAKYEPEYFVSHRMTASASSRASTSVASAYAGVSDNPDLERQIREKTRHQQTDKMFALAFYNL
PLVSRLRQLRTNQIGKLLSVSGTVTRTSEVRPELSLGTFICEGCKTVVPNVEQTFKYTEPMDCPNKTCGNRVGWR
LDIGKSTFVDWQKVKLQESSHEIPTGSMPRTMDVILRGEMVDRAKAGERCVFTGTLIVVPDVSQLGLPGVRPEAV
RDNNSFRGNEVGGSGVSGLKSLGVRDLTYRLAFLSCMVTPDTTTPGQKPEQQLSGQSNNILASLNQNQEDDLGDE
SAQEAFLHSLTSAEVQDLKGLVHSDYIYSRLVDSIAPMIWGHRQIKKGLLLQLIGGVGKSTSIESMKLRGDINIC
IVGDPSTSKSQFLKYVCSLHPRAVYTSGKASTAAGLTASVVKDPETGEFTIEAGALMLANGGGICAIDEFDKMDI
ADQVAIHEAMEQQTISIAKAGIHTTLNARASILAAANPVNGRYDPKQTLRNNLNFSAPIMSRFDVFFVIRDDPKE
SVDRSLANHIVNVHMYRDEAVEPELSTEQLQRYIRFARTFRPVFTEEAKTLLVEKYKELRSNDAQGGVGRSSYRI
TVRQLESLIRLSEAVAKANCVEEVVPKFVIEAYDLLRQSIVTVEKDDVEIEDDVPTHTNDGDEDQDMADGDNDGD
SPMRDVAEPAQAAAQPERQKTKITYDKYAKILNQIVRRVHEDEVNSGEGVEQEDLVLWYLEQIEGELNTKEDYER
ERELAGKVLKRMVKDKLLLRISGSGLTDGTDDDAQNDGKVLFVMHPDCAFEEM*
Coding >Pro_DTO377G3_2|g7362.t1
ATGTCTTCCCTTTTCGACGCCGTGATCCAGTCCGAGCTGGGCTCTGCGCCTTCTCGCGATCGAAACCTCCGCTCC
GATAATCTGCCCAGCTCCCGGCGCTCGGAAAGCAATGGCCCTATGAGTGATATGAATGCCTTCCCAGATGACCAA
GTCGTCGGAGCGGGAAGTTCGGCAATCAGCCGTATGCGGAATCCATATGCCCCTGCGGCGCCGCCGGTGGTCGAT
GAGGCGGCAGAGAAAGTTCAGCAGGCATTTGAAGAGCTGCTCGAGTCATACATCGACGAACCCTCGTCTTCTGCA
CCGCCCTCATCAGGGGAGTTTCTTAGTGACAAGTATTATATCGCTCAGATTAAGGGGATGAAAAAATTCGAGCTG
TCAACTCTCTACGTTGATTTCACGCACATCCATAATCCCGTCTTGGCAGATGCCATTGCCAGCCAATACTATCGG
TTCCAACCCTTCCTTACTAAGGGACTACACAATCTCATCGCCAAGTACGAACCAGAATACTTCGTCTCCCACCGA
ATGACTGCCAGCGCCTCTTCGCGAGCCAGCACCTCGGTTGCCTCAGCATATGCGGGAGTTTCAGATAATCCCGAC
CTCGAGCGTCAGATCCGCGAGAAAACTCGCCACCAGCAAACCGACAAAATGTTTGCCCTTGCATTTTATAACCTA
CCTTTGGTTTCCAGACTGCGACAGCTTCGGACGAATCAGATCGGAAAATTGCTTTCCGTCTCTGGAACTGTCACA
AGAACTTCAGAGGTCAGACCAGAATTATCACTGGGAACTTTTATCTGCGAAGGTTGCAAGACAGTAGTTCCAAAT
GTTGAGCAGACTTTCAAATATACGGAGCCAATGGATTGCCCCAATAAGACCTGCGGCAACCGCGTGGGATGGCGT
CTGGATATCGGAAAAAGTACATTTGTCGATTGGCAAAAAGTCAAGCTCCAGGAATCATCGCACGAAATCCCGACT
GGTAGTATGCCACGCACAATGGATGTCATTTTGCGTGGTGAGATGGTTGATCGCGCCAAGGCTGGGGAACGCTGC
GTATTTACAGGCACCTTGATTGTTGTTCCTGATGTCAGTCAATTGGGTCTTCCCGGTGTGCGCCCTGAGGCCGTC
CGCGATAACAACTCCTTCCGGGGCAACGAGGTCGGTGGTAGTGGAGTCTCTGGATTGAAGTCTCTGGGCGTACGT
GATCTGACTTACCGATTGGCCTTCCTTTCATGCATGGTTACTCCAGACACAACCACTCCTGGCCAAAAGCCAGAG
CAGCAGCTGAGTGGCCAGTCAAATAATATTCTGGCTTCTTTGAACCAAAACCAGGAGGATGACCTTGGAGATGAA
TCAGCCCAAGAAGCTTTCCTACATAGTCTTACCTCGGCTGAAGTCCAGGATCTCAAGGGACTGGTGCACTCGGAT
TATATTTACTCTCGGCTTGTGGATTCGATTGCCCCCATGATTTGGGGTCATCGTCAAATCAAGAAGGGTCTGCTT
TTGCAGTTGATTGGTGGTGTCGGCAAGTCCACATCGATTGAGAGCATGAAACTTCGTGGTGATATCAATATTTGT
ATTGTTGGCGATCCGTCGACCAGTAAGAGTCAGTTCTTGAAATACGTCTGCTCACTGCACCCTCGTGCAGTATAC
ACCAGTGGTAAAGCCTCTACGGCAGCTGGTTTGACCGCTTCGGTGGTGAAGGATCCCGAGACAGGCGAGTTCACC
ATTGAAGCCGGTGCACTGATGCTCGCGAATGGTGGTGGTATTTGTGCCATCGACGAGTTCGACAAGATGGATATC
GCCGATCAGGTCGCTATTCACGAGGCCATGGAACAGCAGACAATTTCTATTGCCAAGGCTGGTATCCATACTACT
CTCAATGCCCGTGCATCAATTCTCGCTGCCGCTAACCCTGTTAATGGTCGTTACGACCCGAAGCAAACTCTTCGG
AACAACTTGAACTTTAGCGCTCCCATTATGAGTCGTTTCGATGTGTTCTTTGTTATCCGCGATGATCCAAAGGAG
TCTGTTGACCGCAGTTTGGCCAACCACATTGTTAACGTACACATGTACCGCGATGAGGCTGTTGAGCCCGAGCTG
AGCACAGAACAACTGCAGCGCTACATCCGGTTCGCACGCACATTCCGCCCAGTCTTCACGGAGGAGGCAAAGACA
CTGCTGGTCGAGAAATACAAGGAGCTGCGCTCCAACGACGCCCAGGGAGGCGTGGGCCGCTCTTCATACCGCATC
ACTGTTCGCCAGCTCGAGTCTTTGATCCGTTTGTCTGAGGCTGTCGCCAAGGCCAACTGTGTCGAGGAGGTAGTT
CCCAAGTTCGTCATTGAGGCATACGATCTTCTCCGCCAGAGTATCGTGACTGTCGAGAAAGATGATGTTGAGATT
GAAGATGATGTACCTACTCACACCAACGATGGCGATGAAGACCAGGATATGGCCGATGGCGATAATGATGGCGAC
AGCCCTATGCGTGACGTTGCAGAGCCTGCTCAAGCTGCTGCCCAGCCAGAACGCCAGAAGACCAAGATCACCTAT
GACAAGTACGCCAAGATCCTGAACCAGATTGTCAGGCGGGTACATGAGGATGAGGTGAACTCGGGCGAGGGTGTC
GAGCAAGAAGATCTTGTACTCTGGTACTTGGAGCAAATTGAGGGTGAACTTAACACCAAAGAAGATTACGAGCGC
GAGCGCGAGTTGGCAGGCAAGGTCTTGAAACGCATGGTTAAGGACAAGCTCTTGCTGCGTATCTCCGGGTCTGGC
CTCACGGATGGAACCGATGACGACGCCCAAAATGACGGAAAGGTCCTTTTCGTCATGCATCCTGATTGTGCCTTC
GAGGAGATGTGA
Transcript >Pro_DTO377G3_2|g7362.t1
ATGTCTTCCCTTTTCGACGCCGTGATCCAGTCCGAGCTGGGCTCTGCGCCTTCTCGCGATCGAAACCTCCGCTCC
GATAATCTGCCCAGCTCCCGGCGCTCGGAAAGCAATGGCCCTATGAGTGATATGAATGCCTTCCCAGATGACCAA
GTCGTCGGAGCGGGAAGTTCGGCAATCAGCCGTATGCGGAATCCATATGCCCCTGCGGCGCCGCCGGTGGTCGAT
GAGGCGGCAGAGAAAGTTCAGCAGGCATTTGAAGAGCTGCTCGAGTCATACATCGACGAACCCTCGTCTTCTGCA
CCGCCCTCATCAGGGGAGTTTCTTAGTGACAAGTATTATATCGCTCAGATTAAGGGGATGAAAAAATTCGAGCTG
TCAACTCTCTACGTTGATTTCACGCACATCCATAATCCCGTCTTGGCAGATGCCATTGCCAGCCAATACTATCGG
TTCCAACCCTTCCTTACTAAGGGACTACACAATCTCATCGCCAAGTACGAACCAGAATACTTCGTCTCCCACCGA
ATGACTGCCAGCGCCTCTTCGCGAGCCAGCACCTCGGTTGCCTCAGCATATGCGGGAGTTTCAGATAATCCCGAC
CTCGAGCGTCAGATCCGCGAGAAAACTCGCCACCAGCAAACCGACAAAATGTTTGCCCTTGCATTTTATAACCTA
CCTTTGGTTTCCAGACTGCGACAGCTTCGGACGAATCAGATCGGAAAATTGCTTTCCGTCTCTGGAACTGTCACA
AGAACTTCAGAGGTCAGACCAGAATTATCACTGGGAACTTTTATCTGCGAAGGTTGCAAGACAGTAGTTCCAAAT
GTTGAGCAGACTTTCAAATATACGGAGCCAATGGATTGCCCCAATAAGACCTGCGGCAACCGCGTGGGATGGCGT
CTGGATATCGGAAAAAGTACATTTGTCGATTGGCAAAAAGTCAAGCTCCAGGAATCATCGCACGAAATCCCGACT
GGTAGTATGCCACGCACAATGGATGTCATTTTGCGTGGTGAGATGGTTGATCGCGCCAAGGCTGGGGAACGCTGC
GTATTTACAGGCACCTTGATTGTTGTTCCTGATGTCAGTCAATTGGGTCTTCCCGGTGTGCGCCCTGAGGCCGTC
CGCGATAACAACTCCTTCCGGGGCAACGAGGTCGGTGGTAGTGGAGTCTCTGGATTGAAGTCTCTGGGCGTACGT
GATCTGACTTACCGATTGGCCTTCCTTTCATGCATGGTTACTCCAGACACAACCACTCCTGGCCAAAAGCCAGAG
CAGCAGCTGAGTGGCCAGTCAAATAATATTCTGGCTTCTTTGAACCAAAACCAGGAGGATGACCTTGGAGATGAA
TCAGCCCAAGAAGCTTTCCTACATAGTCTTACCTCGGCTGAAGTCCAGGATCTCAAGGGACTGGTGCACTCGGAT
TATATTTACTCTCGGCTTGTGGATTCGATTGCCCCCATGATTTGGGGTCATCGTCAAATCAAGAAGGGTCTGCTT
TTGCAGTTGATTGGTGGTGTCGGCAAGTCCACATCGATTGAGAGCATGAAACTTCGTGGTGATATCAATATTTGT
ATTGTTGGCGATCCGTCGACCAGTAAGAGTCAGTTCTTGAAATACGTCTGCTCACTGCACCCTCGTGCAGTATAC
ACCAGTGGTAAAGCCTCTACGGCAGCTGGTTTGACCGCTTCGGTGGTGAAGGATCCCGAGACAGGCGAGTTCACC
ATTGAAGCCGGTGCACTGATGCTCGCGAATGGTGGTGGTATTTGTGCCATCGACGAGTTCGACAAGATGGATATC
GCCGATCAGGTCGCTATTCACGAGGCCATGGAACAGCAGACAATTTCTATTGCCAAGGCTGGTATCCATACTACT
CTCAATGCCCGTGCATCAATTCTCGCTGCCGCTAACCCTGTTAATGGTCGTTACGACCCGAAGCAAACTCTTCGG
AACAACTTGAACTTTAGCGCTCCCATTATGAGTCGTTTCGATGTGTTCTTTGTTATCCGCGATGATCCAAAGGAG
TCTGTTGACCGCAGTTTGGCCAACCACATTGTTAACGTACACATGTACCGCGATGAGGCTGTTGAGCCCGAGCTG
AGCACAGAACAACTGCAGCGCTACATCCGGTTCGCACGCACATTCCGCCCAGTCTTCACGGAGGAGGCAAAGACA
CTGCTGGTCGAGAAATACAAGGAGCTGCGCTCCAACGACGCCCAGGGAGGCGTGGGCCGCTCTTCATACCGCATC
ACTGTTCGCCAGCTCGAGTCTTTGATCCGTTTGTCTGAGGCTGTCGCCAAGGCCAACTGTGTCGAGGAGGTAGTT
CCCAAGTTCGTCATTGAGGCATACGATCTTCTCCGCCAGAGTATCGTGACTGTCGAGAAAGATGATGTTGAGATT
GAAGATGATGTACCTACTCACACCAACGATGGCGATGAAGACCAGGATATGGCCGATGGCGATAATGATGGCGAC
AGCCCTATGCGTGACGTTGCAGAGCCTGCTCAAGCTGCTGCCCAGCCAGAACGCCAGAAGACCAAGATCACCTAT
GACAAGTACGCCAAGATCCTGAACCAGATTGTCAGGCGGGTACATGAGGATGAGGTGAACTCGGGCGAGGGTGTC
GAGCAAGAAGATCTTGTACTCTGGTACTTGGAGCAAATTGAGGGTGAACTTAACACCAAAGAAGATTACGAGCGC
GAGCGCGAGTTGGCAGGCAAGGTCTTGAAACGCATGGTTAAGGACAAGCTCTTGCTGCGTATCTCCGGGTCTGGC
CTCACGGATGGAACCGATGACGACGCCCAAAATGACGGAAAGGTCCTTTTCGTCATGCATCCTGATTGTGCCTTC
GAGGAGATGTGA
Gene >Pro_DTO377G3_2|g7362.t1
ATGTCTTCCCTTTTCGACGCCGTGATCCAGTCCGAGCTGGGCTCTGCGCCTTCTCGCGATCGAAACCTCCGCTCC
GATAATCTGCCCAGCTCCCGGCGCTCGGAAAGCAATGGCCCTATGAGTGATATGAATGCCTTCCCAGATGACCAA
GTCGTCGGAGCGGGAAGTTCGGCAATCAGCCGTATGCGGAATCCATATGCCCCTGCGGCGCCGCCGGTGGTCGAT
GAGGCGGCAGAGAAAGTTCAGCAGGCATTTGAAGAGCTGCTCGAGTCATACATCGACGAACCCTCGTCTTCTGCA
CCGCCCTCATCAGGGGAGTTTCTTAGTGACAAGTATTATATCGCTCAGATTAAGGGGATGAAAAAATTCGAGCTG
TCAACTCTCTACGTTGATTTCACGCACATCCATAATCCCGTCTTGGCAGATGCCATTGCCAGCCAATACTATCGG
TTCCAACCCTTCCTTACTAAGGGACTACACAATCTCATCGCCAAGTACGAACCAGAATACTTCGTCTCCCACCGA
ATGACTGCCAGCGCCTCTTCGCGAGCCAGCACCTCGGTTGCCTCAGCATATGCGGGAGTTTCAGATAATCCCGAC
CTCGAGCGTCAGATCCGCGAGAAAACTCGCCACCAGCAAACCGACAAAATGTTTGCCCTTGCATTTTATAACCTA
CCTTTGGTTTCCAGACTGCGACAGCTTCGGACGAATCAGATCGGAAAATTGCTTTCCGTCTCTGGAACTGTCACA
AGAACTTCAGAGGTCAGACCAGAATTATCACTGGGAACTTTTATCTGCGAAGGTTGCAAGACAGTAGTTCCAAAT
GTTGAGCAGACTTTCAAATATACGGAGCCAATGGATTGCCCCAATAAGACCTGCGGCAACCGCGTGGGATGGCGT
CTGGATATCGGAAAAAGTACATTTGTCGATTGGCAAAAAGTCAAGCTCCAGGAATCATCGCACGAAATCCCGACT
GGTAGTATGCCACGCACAATGGATGTCATTTTGCGTGGTGAGATGGTTGATCGCGCCAAGGCTGGGGAACGCTGC
GTATTTACAGGCACCTTGATTGTTGTTCCTGATGTCAGTCAATTGGGTCTTCCCGGTGTGCGCCCTGAGGCCGTC
CGCGATAACAACTCCTTCCGGGGCAACGAGGTCGGTGGTAGTGGAGTCTCTGGATTGAAGTCTCTGGGCGTACGT
GATCTGACTTACCGATTGGCCTTCCTTTCATGCATGGTTACTCCAGACACAACCACTCCTGGCCAAAAGCCAGAG
CAGCAGCTGAGTGGCCAGTCAAATAATATTCTGGCTTCTTTGAACCAAAACCAGGAGGATGACCTTGGAGATGAA
TCAGCCCAAGAAGCTTTCCTACATAGTCTTACCTCGGCTGAAGTCCAGGATCTCAAGGGACTGGTGCACTCGGAT
TATATTTACTCTCGGCTTGTGGATTCGATTGCCCCCATGATTTGGGGTCATCGTCAAATCAAGAAGGGTCTGCTT
TTGCAGTTGATTGGTGGTGTCGGCAAGTCCACATCGATTGAGAGCATGAAACTTCGTGGTGATATCAATATTTGT
ATTGTTGGCGATCCGTCGACCAGTAAGAGTCAGTTCTTGAAGTAAGTTTTGCCCACTCCTCATATGTAGACATTG
CTTGCTGACGGGATTACTCAGATACGTCTGCTCACTGCACCCTCGTGCAGTATACACCAGTGGTAAAGCCTCTAC
GGCAGCTGGTTTGACCGCTTCGGTGGTGAAGGATCCCGAGACAGGCGAGTTCACCATTGAAGCCGGTGCACTGAT
GCTCGCGGTATGTTCCAAATGTGGCTCCAACTGAGTGTGGGCTCATCGCTGACATGTTCCTTATAGAATGGTGGT
GGTATTTGTGCCATCGACGAGTTCGACAAGATGGATATCGCCGATCAGGTCGCTATTCACGAGGCCATGGAACAG
CAGACAATTTCTATTGCCAAGGCTGGTATCCATACTACTCTCAATGCCCGTGCATCAATTCTCGCTGCCGCTAAC
CCTGTTAATGGTCGTTACGACCCGAAGCAAACTCTTCGGAACAACTTGAACTTTAGCGCTCCCATTATGAGTCGT
TTCGATGTGTTCTTTGTTATCCGCGATGATCCAAAGGAGTCTGTTGACCGCAGTTTGGCCAACCACATTGTTAAC
GTACACATGTACCGCGATGAGGCTGTTGAGCCCGAGCTGAGCACAGAACAACTGCAGCGCTACATCCGGTTCGCA
CGCACATTCCGCCCAGTCTTCACGGAGGAGGCAAAGACACTGCTGGTCGAGAAATACAAGGAGCTGCGCTCCAAC
GACGCCCAGGGAGGCGTGGGCCGCTCTTCATACCGCATCACTGTTCGCCAGCTCGAGTCTTTGATCCGTTTGTCT
GAGGCTGTCGCCAAGGCCAACTGTGTCGAGGAGGTAGTTCCCAAGTTCGTCATTGAGGCATACGATCTTCTCCGC
CAGAGTATCGTGACTGTCGAGAAAGATGATGTTGAGATTGAAGATGATGTACCTACTCACACCAACGATGGCGAT
GAAGACCAGGATATGGCCGATGGCGATAATGATGGCGACAGCCCTATGCGTGACGTTGCAGAGCCTGCTCAAGCT
GCTGCCCAGCCAGAACGCCAGAAGACCAAGATCACCTATGACAAGTACGCCAAGATCCTGAACCAGATTGTCAGG
CGGGTACATGAGGATGAGGTGAACTCGGGCGAGGGTGTCGAGCAAGAAGATCTTGTACTCTGGTACTTGGAGCAA
ATTGAGGGTGAACTTAACACCAAAGAAGATTACGAGCGCGAGCGCGAGTTGGCAGGCAAGGTCTTGAAACGCATG
GTTAAGGTTAGTAGATCTTCCTTTGCTATGGCAATATTCGTAAATTTCCATCAAGCAACGTCACTAATAAAGTTA
CTCTATAGGACAAGCTCTTGCTGCGTATCTCCGGGTCTGGCCTCACGGATGGAACCGATGACGACGCCCAAAATG
ACGGAAAGGTCCTTTTCGTCATGCATCCTGATTGTGCCTTCGAGGAGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail