Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7348.t1
Gene name
Locationscaffold_22:303152..304805
Strand+
Gene length (bp)1653
Transcript length (bp)1419
Coding sequence length (bp)1419
Protein length (aa) 473

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00909 Ammonium_transp Ammonium Transporter Family 9.4E-111 36 433

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0008519 ammonium transmembrane transporter activity Yes
GO:0072488 ammonium transmembrane transport Yes
GO:0055085 transmembrane transport No
GO:0022803 passive transmembrane transporter activity No
GO:0006810 transport No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0022857 transmembrane transporter activity No
GO:0051234 establishment of localization No
GO:0098655 cation transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0008324 cation transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015267 channel activity No
GO:0098660 inorganic ion transmembrane transport No
GO:0006812 cation transport No
GO:0006811 ion transport No
GO:0005216 ion channel activity No
GO:0098662 inorganic cation transmembrane transport No
GO:0005261 cation channel activity No
GO:0015075 ion transmembrane transporter activity No
GO:0051179 localization No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0071705 nitrogen compound transport No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 33 55 22
2 62 84 22
3 123 145 22
4 150 172 22
5 187 209 22
6 222 240 18
7 255 277 22
8 284 306 22
9 310 332 22
10 345 367 22
11 387 409 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Orthologs

Orthofinder run ID2
Orthogroup4179
Change Orthofinder run
Species Protein ID
Penicillium roqueforti DTO002I6 Pro_DTO002I6_2|g4747.t1
Penicillium roqueforti DTO003C3 Pro_DTO003C3_2|g6597.t1
Penicillium roqueforti DTO003H1 (CBS 147308) Pro_DTO003H1_2|g4138.t1
Penicillium roqueforti DTO006G1 Pro_DTO006G1_2|g1465.t1
Penicillium roqueforti DTO006G7 Pro_DTO006G7_3|g1405.t1
Penicillium roqueforti DTO012A1 Pro_DTO012A1_2|g7317.t1
Penicillium roqueforti DTO012A2 (CBS 147309) Pro_DTO012A2_2|g3044.t1
Penicillium roqueforti DTO012A6 (CBS 147310) Pro_DTO012A6_2|g7703.t1
Penicillium roqueforti DTO012A7 Pro_DTO012A7_2|g1235.t1
Penicillium roqueforti DTO012A8 Pro_DTO012A8_2|g2791.t1
Penicillium roqueforti DTO012A9 Pro_DTO012A9_2|g1272.t1
Penicillium roqueforti DTO013E5 Pro_DTO013E5_2|g5945.t1
Penicillium roqueforti DTO013F2 Pro_DTO013F2_2|g3679.t1
Penicillium roqueforti DTO013F5 (CBS 147311) Pro_DTO013F5_2|g6611.t1
Penicillium roqueforti DTO027I6 Pro_DTO027I6_2|g6523.t1
Penicillium roqueforti DTO032C6 Pro_DTO032C6_2|g2711.t1
Penicillium roqueforti DTO039G3 Pro_DTO039G3_2|g2884.t1
Penicillium roqueforti DTO046C5 Pro_DTO046C5_2|g5519.t1
Penicillium roqueforti DTO070G2 (CBS 147317) Pro_DTO070G2_2|g5950.t1
Penicillium roqueforti DTO081F9 (CBS 147318) Pro_DTO081F9_2|g2612.t1
Penicillium roqueforti DTO101D6 (CBS 147325) Pro_DTO101D6_2|g2787.t1
Penicillium roqueforti DTO102I9 (CBS 147326) Pro_DTO102I9_2|g4502.t1
Penicillium roqueforti DTO126G2 (CBS 147330) Pro_DTO126G2_2|g2476.t1
Penicillium roqueforti DTO127F7 (CBS 147331) Pro_DTO127F7_2|g1789.t1
Penicillium roqueforti DTO127F9 (CBS 147332) Pro_DTO127F9_2|g677.t1
Penicillium roqueforti DTO130C1 (CBS 147333) Pro_DTO130C1_2|g474.t1
Penicillium roqueforti DTO163C3 (CBS 147337) Pro_DTO163C3_2|g3125.t1
Penicillium roqueforti DTO163F5 (CBS 147338) Pro_DTO163F5_2|g3952.t1
Penicillium roqueforti DTO163G4 (CBS 147339) Pro_DTO163G4_2|g7819.t1
Penicillium roqueforti DTO265D5 (CBS 147372) Pro_DTO265D5_2|g4619.t1
Penicillium roqueforti DTO369A1 (CBS 147354) Pro_DTO369A1_2|g6562.t1
Penicillium roqueforti DTO375B1 (CBS 147355) Pro_DTO375B1_2|g2138.t1
Penicillium roqueforti DTO377G2 (LCP 96.3914a) Pro_DTO377G2_2|g7795.t1
Penicillium roqueforti LCP96 04111 Pro_DTO377G3_2|g7348.t1 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7348.t1
MADSPVYNASTPTGGDPLKVDVNAQYAGVEWNYTYIILCSFIVWLIIPGIGLLYSGLARRKSALALLFQSFMIAA
VITFQWMFWGYSLAYARDASPFIGTLKNFGLRGVMVAPSPGSADLPEIVFCFYQLLFCACTVMIVVGGAFERGNM
IPSLIFGFCWATVVYCPLACWTWNSNGWLYNLPSLDFAGGGPVHIASGWSALAYAFVLGKRKDIDKPSHAKPHNT
TLVFLGTSLIWFGWFGFNGGSTLNASMRAMLAVFNTNTAACTGVLGWVLVDYIKYRGKFSVVGACEGAIAGLVGI
TPAAGFVSVWLAAVIGFLTSIVCALLQNINEWLHIDEGMDVFKLHGIGGMVGAFLTGIFASQSIAALDGVTEATG
GINGNGVQVGKQLAEVCAISAYSFVVSCILLYIINFIPGMQLRVHEEVEMVGLDRTQFIDEQIGERALLDDLCGS
SSPASVLNGQLPVVVGSEGTKE*
Coding >Pro_DTO377G3_2|g7348.t1
ATGGCCGACTCTCCAGTCTACAATGCATCTACCCCAACAGGCGGAGATCCACTCAAGGTCGATGTAAATGCTCAA
TATGCAGGCGTCGAGTGGAACTATACCTACATCATCCTCTGCTCGTTCATTGTTTGGTTGATCATCCCCGGGATT
GGTCTTCTCTACAGTGGTCTTGCACGGAGAAAATCAGCACTGGCATTACTCTTCCAGTCGTTCATGATTGCGGCC
GTGATAACGTTCCAATGGATGTTCTGGGGTTACTCGTTAGCCTATGCCCGGGATGCAAGTCCCTTCATTGGAACC
CTTAAGAACTTCGGTCTGAGAGGTGTGATGGTAGCACCATCGCCTGGCTCGGCGGATCTCCCGGAGATTGTGTTC
TGCTTTTATCAGCTTCTATTCTGCGCATGCACGGTCATGATCGTTGTTGGCGGAGCTTTCGAACGAGGCAACATG
ATCCCCTCGCTGATCTTCGGCTTCTGCTGGGCAACCGTCGTCTACTGTCCCCTAGCCTGTTGGACCTGGAACAGC
AACGGGTGGCTGTATAACCTCCCATCACTTGATTTCGCCGGCGGCGGCCCGGTTCACATCGCATCTGGCTGGTCA
GCATTGGCTTATGCCTTTGTTTTGGGGAAGCGCAAGGATATCGACAAGCCTTCACATGCGAAACCCCACAACACC
ACCTTAGTCTTCTTAGGCACGTCCTTGATCTGGTTTGGATGGTTCGGGTTCAACGGCGGCTCGACTCTAAATGCT
AGCATGCGGGCAATGCTAGCGGTATTTAACACCAACACTGCGGCTTGCACAGGCGTACTCGGATGGGTGCTGGTT
GACTATATTAAGTATCGTGGGAAGTTTTCGGTCGTGGGGGCATGCGAAGGCGCAATCGCAGGGCTAGTAGGCATC
ACGCCAGCCGCCGGATTTGTGTCCGTGTGGCTTGCTGCCGTCATCGGGTTCCTCACGAGCATCGTCTGCGCGCTC
CTCCAAAACATCAATGAGTGGTTACACATAGACGAGGGGATGGATGTGTTCAAGCTGCACGGTATCGGCGGAATG
GTGGGGGCATTCCTTACCGGCATCTTTGCGTCGCAATCTATTGCCGCGTTGGATGGCGTGACCGAGGCCACTGGT
GGCATTAACGGCAATGGAGTGCAGGTTGGAAAACAATTGGCCGAGGTGTGTGCTATCTCGGCATATTCTTTTGTT
GTCTCCTGTATCCTGCTTTACATTATCAATTTCATACCGGGGATGCAGTTGCGCGTGCATGAGGAGGTGGAAATG
GTTGGCCTGGACCGCACGCAGTTTATCGATGAGCAGATTGGTGAGCGGGCGCTGCTTGACGATCTATGCGGGTCT
TCATCACCTGCAAGTGTGCTTAATGGGCAGCTTCCTGTAGTGGTTGGGTCTGAGGGAACGAAGGAATGA
Transcript >Pro_DTO377G3_2|g7348.t1
ATGGCCGACTCTCCAGTCTACAATGCATCTACCCCAACAGGCGGAGATCCACTCAAGGTCGATGTAAATGCTCAA
TATGCAGGCGTCGAGTGGAACTATACCTACATCATCCTCTGCTCGTTCATTGTTTGGTTGATCATCCCCGGGATT
GGTCTTCTCTACAGTGGTCTTGCACGGAGAAAATCAGCACTGGCATTACTCTTCCAGTCGTTCATGATTGCGGCC
GTGATAACGTTCCAATGGATGTTCTGGGGTTACTCGTTAGCCTATGCCCGGGATGCAAGTCCCTTCATTGGAACC
CTTAAGAACTTCGGTCTGAGAGGTGTGATGGTAGCACCATCGCCTGGCTCGGCGGATCTCCCGGAGATTGTGTTC
TGCTTTTATCAGCTTCTATTCTGCGCATGCACGGTCATGATCGTTGTTGGCGGAGCTTTCGAACGAGGCAACATG
ATCCCCTCGCTGATCTTCGGCTTCTGCTGGGCAACCGTCGTCTACTGTCCCCTAGCCTGTTGGACCTGGAACAGC
AACGGGTGGCTGTATAACCTCCCATCACTTGATTTCGCCGGCGGCGGCCCGGTTCACATCGCATCTGGCTGGTCA
GCATTGGCTTATGCCTTTGTTTTGGGGAAGCGCAAGGATATCGACAAGCCTTCACATGCGAAACCCCACAACACC
ACCTTAGTCTTCTTAGGCACGTCCTTGATCTGGTTTGGATGGTTCGGGTTCAACGGCGGCTCGACTCTAAATGCT
AGCATGCGGGCAATGCTAGCGGTATTTAACACCAACACTGCGGCTTGCACAGGCGTACTCGGATGGGTGCTGGTT
GACTATATTAAGTATCGTGGGAAGTTTTCGGTCGTGGGGGCATGCGAAGGCGCAATCGCAGGGCTAGTAGGCATC
ACGCCAGCCGCCGGATTTGTGTCCGTGTGGCTTGCTGCCGTCATCGGGTTCCTCACGAGCATCGTCTGCGCGCTC
CTCCAAAACATCAATGAGTGGTTACACATAGACGAGGGGATGGATGTGTTCAAGCTGCACGGTATCGGCGGAATG
GTGGGGGCATTCCTTACCGGCATCTTTGCGTCGCAATCTATTGCCGCGTTGGATGGCGTGACCGAGGCCACTGGT
GGCATTAACGGCAATGGAGTGCAGGTTGGAAAACAATTGGCCGAGGTGTGTGCTATCTCGGCATATTCTTTTGTT
GTCTCCTGTATCCTGCTTTACATTATCAATTTCATACCGGGGATGCAGTTGCGCGTGCATGAGGAGGTGGAAATG
GTTGGCCTGGACCGCACGCAGTTTATCGATGAGCAGATTGGTGAGCGGGCGCTGCTTGACGATCTATGCGGGTCT
TCATCACCTGCAAGTGTGCTTAATGGGCAGCTTCCTGTAGTGGTTGGGTCTGAGGGAACGAAGGAATGA
Gene >Pro_DTO377G3_2|g7348.t1
ATGGCCGACTCTGTAAGTCTAGTATGATGGAAATGACACTTGCACACAGCTGACACAGTCATATAATATAGCCAG
TCTACAATGCATCTACCCCAACAGGCGGAGATCCACTCAAGGTCGATGTAAATGCTCAATATGCAGGCGTCGAGT
GGAACTATACCTACATCATCCTCTGCTCGTTCATTGTTTGGTTGATCATCCCCGGGATTGGTCTTCTCTACAGTG
GTCTTGCACGGAGAAAATCAGCACTGGCATTACTCTTCCAGTCGTTCATGATTGCGGCCGTGTACGTTAAGGTCT
TCTTCAAAATCCACGCGTACATCGTACTGACACCATATATCCCGCCAGGATAACGTTCCAATGGATGTTCTGGGG
TTACTCGTTAGCCTATGCCCGGGATGCAAGTCCCTTCATTGGAACCCTTAAGAACTTCGGTCTGAGAGGTGTGAT
GGTAGCACCATCGCCTGGCTCGGCGGATCTCCCGGAGATTGTGTTCTGCTTTTATCAGCTTCTATTCTGCGCATG
CACGGTAAGCAACACATAAAACAGAATGTCGCGAGACTGGATCTAATGGAATGCTGCGGTAGGTCATGATCGTTG
TTGGCGGAGCTTTCGAACGAGGCAACATGATCCCCTCGCTGATCTTCGGCTTCTGCTGGGCAACCGTCGTCTACT
GTCCCCTAGCCTGTTGGACCTGGAACAGCAACGGGTGGCTGTATAACCTCCCATCACTTGATTTCGCCGGCGGCG
GCCCGGTTCACATCGCATCTGGCTGGTCAGCATTGGCTTATGCCTTTGTTTTGGGGAAGCGCAAGGATATCGACA
AGCCTTCACATGCGAAACCCCACAACACCACCTTAGTCTTCTTAGGCACGTCCTTGATCTGGTTTGGATGGTTCG
GGTTCAACGTATGTCACACCTGTGCCTTTTCTAAACTCAAGTCTGACAGCAGAGATTTCTTAGGGCGGCTCGACT
CTAAATGCTAGCATGCGGGCAATGCTAGCGGTATTTAACACCAACACTGCGGCTTGCACAGGCGTACTCGGATGG
GTGCTGGTTGACTATATTAAGTATCGTGGGAAGTTTTCGGTCGTGGGGGCATGCGAAGGCGCAATCGCAGGGCTA
GTAGGCATCACGCCAGCCGCCGGATTTGTGTCCGTGTGGCTTGCTGCCGTCATCGGGTTCCTCACGAGCATCGTC
TGCGCGCTCCTCCAAAACATCAATGAGTGGTTACACATAGACGAGGGGATGGATGTGTTCAAGCTGCACGGTATC
GGCGGAATGGTGGGGGCATTCCTTACCGGCATCTTTGCGTCGCAATCTATTGCCGCGTTGGATGGCGTGACCGAG
GCCACTGGTGGCATTAACGGCAATGGAGTGCAGGTTGGAAAACAATTGGCCGAGGTGTGTGCTATCTCGGCATAT
TCTTTTGTTGTCTCCTGTATCCTGCTTTACATTATCAATTTCATACCGGGGATGCAGTTGCGCGTGCATGAGGAG
GTGGAAATGGTTGGCCTGGACCGCACGCAGTTTATCGATGAGCAGATTGGTGAGCGGGCGCTGCTTGACGATCTA
TGCGGGTCTTCATCACCTGCAAGTGTGCTTAATGGGCAGCTTCCTGTAGTGGTTGGGTCTGAGGGAACGAAGGAA
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail