Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7325.t1
Gene name
Locationscaffold_22:234939..236667
Strand+
Gene length (bp)1728
Transcript length (bp)1548
Coding sequence length (bp)1548
Protein length (aa) 516

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 9.2E-31 32 132
PF00085 Thioredoxin Thioredoxin 1.8E-26 366 472
PF13848 Thioredoxin_6 Thioredoxin-like domain 2.1E-06 68 159
PF13848 Thioredoxin_6 Thioredoxin-like domain 8.5E-32 165 343
PF01216 Calsequestrin Calsequestrin 1.4E-12 70 247

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0005488 binding No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7325.t1
MRSFAPLVLSLLGATAAVHAAEPEVADTDANVVTLTTETFDEFVKEHPLVLAEFYAPWCGHCKALAPHYEEAATE
LKAKDIPVIKVDCTVEEELCRTYEVDGYPTLKVFRGPDAHKPYAGARKSDAIISYMTKQSMPAVSNVNEENLEEF
KALDKIVIIGYVASDDSASNKSFTSFAESQRDNFLFAASNDAALAKAEGAKQPSIVLYKEFDEKVAVYDGKLEEE
AILEWVKTASTPLVGELGPETYSKYMAAGIPLAYIFAETPEEREQLAADFRPIAENHRGAINIVTLDAKLFGAHA
GNLNLEPEKFPAFAIQDTTKNAKYPYDQTKKVDAKDIGKFIKDVLEGKVEPSLKSEPIPETQEGSVTVVVGRNYQ
EVVVDNEKDVLVEFYAPWCGHCKSLAPKYEELAALYADVPELNEKVTVAKVDATANDVPDSITGFPTIKLYPAGA
KDSPIEYSGSRTVEDLVAFIKENGKYQADGLADGSKKPEERAEVTSAPKATESPASDEKDIHDEL*
Coding >Pro_DTO377G3_2|g7325.t1
ATGCGGTCTTTCGCCCCTCTGGTCCTGAGCCTTCTCGGAGCTACTGCGGCAGTCCACGCTGCTGAGCCTGAAGTT
GCCGACACTGACGCCAATGTCGTCACCTTGACAACCGAAACCTTTGATGAATTCGTCAAGGAGCACCCTTTGGTG
CTTGCTGAGTTCTATGCGCCTTGGTGCGGTCACTGCAAGGCCCTTGCACCCCATTATGAGGAGGCTGCCACAGAG
CTGAAGGCCAAGGATATCCCCGTGATCAAGGTGGATTGCACCGTGGAAGAGGAGCTCTGCCGAACCTACGAAGTT
GATGGCTACCCTACTCTGAAGGTATTCCGTGGCCCCGATGCACACAAGCCCTACGCTGGTGCCCGCAAGTCCGAC
GCAATCATTTCATACATGACCAAGCAGTCTATGCCCGCCGTCTCGAACGTGAACGAGGAGAACCTAGAGGAATTC
AAGGCCTTGGACAAGATTGTTATTATTGGATACGTGGCTTCTGACGACAGCGCCTCCAACAAGAGCTTCACTTCG
TTCGCTGAATCCCAGCGTGACAACTTCCTCTTCGCTGCCTCCAACGATGCTGCTCTCGCTAAGGCCGAGGGCGCC
AAGCAGCCCTCGATTGTTCTCTACAAGGAATTCGATGAGAAGGTGGCCGTTTACGACGGAAAGCTGGAGGAAGAG
GCCATCCTTGAATGGGTCAAGACCGCTAGTACTCCTCTTGTTGGCGAGCTTGGTCCCGAGACTTACTCAAAGTAC
ATGGCGGCCGGTATTCCCCTGGCTTACATCTTTGCCGAGACTCCCGAGGAGCGCGAGCAGCTCGCTGCTGATTTC
CGTCCCATCGCTGAGAACCACCGTGGAGCTATCAACATTGTTACCCTTGATGCTAAGCTCTTCGGCGCTCACGCC
GGCAACCTTAACCTTGAGCCCGAGAAGTTCCCTGCTTTCGCTATCCAGGACACTACTAAGAACGCCAAGTACCCT
TACGATCAGACTAAGAAGGTTGATGCCAAGGATATCGGCAAGTTCATCAAGGATGTCCTTGAGGGCAAGGTTGAG
CCTAGCCTCAAGTCCGAGCCCATTCCCGAGACTCAGGAGGGATCTGTTACTGTTGTTGTTGGCCGCAACTACCAG
GAGGTTGTCGTTGATAACGAAAAGGATGTGCTGGTCGAGTTCTACGCTCCCTGGTGCGGACACTGCAAGTCTCTT
GCTCCCAAGTACGAAGAGCTTGCTGCGTTGTATGCCGATGTCCCCGAGTTGAATGAGAAGGTCACTGTCGCCAAA
GTCGACGCCACTGCCAACGATGTGCCAGATTCCATCACTGGCTTCCCCACCATCAAGCTCTACCCCGCTGGTGCT
AAGGACTCACCTATTGAGTACTCTGGTTCCCGTACCGTGGAGGACCTAGTCGCCTTCATCAAGGAGAACGGCAAG
TATCAGGCGGACGGCCTGGCCGATGGCTCCAAGAAGCCCGAGGAGCGTGCCGAGGTCACTTCGGCCCCCAAGGCC
ACCGAGTCTCCCGCATCCGATGAGAAGGATATTCATGACGAGCTTTAA
Transcript >Pro_DTO377G3_2|g7325.t1
ATGCGGTCTTTCGCCCCTCTGGTCCTGAGCCTTCTCGGAGCTACTGCGGCAGTCCACGCTGCTGAGCCTGAAGTT
GCCGACACTGACGCCAATGTCGTCACCTTGACAACCGAAACCTTTGATGAATTCGTCAAGGAGCACCCTTTGGTG
CTTGCTGAGTTCTATGCGCCTTGGTGCGGTCACTGCAAGGCCCTTGCACCCCATTATGAGGAGGCTGCCACAGAG
CTGAAGGCCAAGGATATCCCCGTGATCAAGGTGGATTGCACCGTGGAAGAGGAGCTCTGCCGAACCTACGAAGTT
GATGGCTACCCTACTCTGAAGGTATTCCGTGGCCCCGATGCACACAAGCCCTACGCTGGTGCCCGCAAGTCCGAC
GCAATCATTTCATACATGACCAAGCAGTCTATGCCCGCCGTCTCGAACGTGAACGAGGAGAACCTAGAGGAATTC
AAGGCCTTGGACAAGATTGTTATTATTGGATACGTGGCTTCTGACGACAGCGCCTCCAACAAGAGCTTCACTTCG
TTCGCTGAATCCCAGCGTGACAACTTCCTCTTCGCTGCCTCCAACGATGCTGCTCTCGCTAAGGCCGAGGGCGCC
AAGCAGCCCTCGATTGTTCTCTACAAGGAATTCGATGAGAAGGTGGCCGTTTACGACGGAAAGCTGGAGGAAGAG
GCCATCCTTGAATGGGTCAAGACCGCTAGTACTCCTCTTGTTGGCGAGCTTGGTCCCGAGACTTACTCAAAGTAC
ATGGCGGCCGGTATTCCCCTGGCTTACATCTTTGCCGAGACTCCCGAGGAGCGCGAGCAGCTCGCTGCTGATTTC
CGTCCCATCGCTGAGAACCACCGTGGAGCTATCAACATTGTTACCCTTGATGCTAAGCTCTTCGGCGCTCACGCC
GGCAACCTTAACCTTGAGCCCGAGAAGTTCCCTGCTTTCGCTATCCAGGACACTACTAAGAACGCCAAGTACCCT
TACGATCAGACTAAGAAGGTTGATGCCAAGGATATCGGCAAGTTCATCAAGGATGTCCTTGAGGGCAAGGTTGAG
CCTAGCCTCAAGTCCGAGCCCATTCCCGAGACTCAGGAGGGATCTGTTACTGTTGTTGTTGGCCGCAACTACCAG
GAGGTTGTCGTTGATAACGAAAAGGATGTGCTGGTCGAGTTCTACGCTCCCTGGTGCGGACACTGCAAGTCTCTT
GCTCCCAAGTACGAAGAGCTTGCTGCGTTGTATGCCGATGTCCCCGAGTTGAATGAGAAGGTCACTGTCGCCAAA
GTCGACGCCACTGCCAACGATGTGCCAGATTCCATCACTGGCTTCCCCACCATCAAGCTCTACCCCGCTGGTGCT
AAGGACTCACCTATTGAGTACTCTGGTTCCCGTACCGTGGAGGACCTAGTCGCCTTCATCAAGGAGAACGGCAAG
TATCAGGCGGACGGCCTGGCCGATGGCTCCAAGAAGCCCGAGGAGCGTGCCGAGGTCACTTCGGCCCCCAAGGCC
ACCGAGTCTCCCGCATCCGATGAGAAGGATATTCATGACGAGCTTTAA
Gene >Pro_DTO377G3_2|g7325.t1
ATGCGGTCTTTCGCCCCTCTGGTCCTGAGCCTTCTCGGAGCTACTGCGGCAGTCCACGCTGCTGAGCCTGAAGTT
GCCGACACTGACGCCAATGTCGTCACCTTGACAACCGAAACCTTTGATGAATTCGTCAAGGAGCACCCTTTGGTG
CTTGCTGAGTTCTATGCGCCTTGGTGCGGTCACTGCAAGGCCCTTGCACCCCATTATGAGGAGGCTGCCACAGAG
CTGAAGGCCAAGGATATCCCCGTGATCAAGGTGGATTGCACCGTGGAAGAGGAGCTCTGCCGAACCTACGAAGTT
GATGGCTACCCTACTCTGAAGGTATTCCGTGGCCCCGATGCACACAAGCCCTACGCTGGTGCCCGCAAGTCCGAC
GCGTAAGTCATTCTAGGTTTCGGGTTCTTGTGCTCTGGAAATTAACGCGTTTCCTCGATAGAATCATTTCATACA
TGACCAAGCAGTCTATGCCCGCCGTCTCGAACGTGAACGAGGAGAACCTAGAGGAATTCAAGGCCTTGGACAAGA
TTGTTATTATTGGATACGTGGCTTCTGACGACAGCGCCTCCAACAAGAGCTTCACTTCGTTCGCTGAATCCCAGC
GTGACAACTTCCTCTTCGCTGCCTCCAACGATGCTGCTCTCGCTAAGGCCGAGGGCGCCAAGCAGCCCTCGATTG
TTCTCTACAAGGAATTCGATGAGAAGGTGGCCGTTTACGACGGAAAGCTGGAGGAAGAGGCCATCCTTGAATGGG
TCAAGACCGCTAGTACTCCTCTTGTTGGCGAGCTTGGTCCCGAGACTTACTCAAAGTACATGGCGGTATGTCTAA
CTTCTTCTGTCCTCGTATTTGAGCAAGAAAAGAAACTGACTTTCTACAACGATTAGGCCGGTATTCCCCTGGCTT
ACATCTTTGCCGAGACTCCCGAGGAGCGCGAGCAGCTCGCTGCTGATTTCCGTCCCATCGCTGAGAACCACCGTG
GAGCTATCAACATTGTTACCCTTGATGCTAAGCTCTTCGGCGCTCACGCCGGCAACCTTAACCTTGAGCCCGAGA
AGTTCCCTGCTTTCGCTATCCAGGACACTACTAAGAACGCCAAGTACCCTTACGATCAGACTAAGAAGGTTGATG
CCAAGGATATCGGCAAGTTCATCAAGGATGTCCTTGAGGGCAAGGTTGAGCCTAGCCTCAAGTCCGAGCCCATTC
CCGAGACTCAGGAGGGATCTGTTACTGTTGTTGTTGGCCGCAACTACCAGGAGGTTGTCGTTGATAACGAAAAGG
ATGTGCTGGTCGAGTTCTACGCTCCCTGGTGCGGACACTGCAAGTCGTAAGTTTTTCACACCTCATCTACCATTT
GTCGCATGTCTAACTCATCATCACAGTCTTGCTCCCAAGTACGAAGAGCTTGCTGCGTTGTATGCCGATGTCCCC
GAGTTGAATGAGAAGGTCACTGTCGCCAAAGTCGACGCCACTGCCAACGATGTGCCAGATTCCATCACTGGCTTC
CCCACCATCAAGCTCTACCCCGCTGGTGCTAAGGACTCACCTATTGAGTACTCTGGTTCCCGTACCGTGGAGGAC
CTAGTCGCCTTCATCAAGGAGAACGGCAAGTATCAGGCGGACGGCCTGGCCGATGGCTCCAAGAAGCCCGAGGAG
CGTGCCGAGGTCACTTCGGCCCCCAAGGCCACCGAGTCTCCCGCATCCGATGAGAAGGATATTCATGACGAGCTT
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail