Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7324.t1
Gene name
Locationscaffold_22:232608..234463
Strand+
Gene length (bp)1855
Transcript length (bp)1782
Coding sequence length (bp)1782
Protein length (aa) 594

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11700 ATG22 Vacuole effluxer Atg22 like 1.4E-213 21 562

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.5

Transmembrane Domains

Domain # Start End Length
1 26 48 22
2 109 131 22
3 144 163 19
4 167 189 22
5 271 293 22
6 303 322 19
7 368 390 22
8 400 422 22
9 434 456 22
10 469 491 22
11 503 525 22
12 535 553 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 110.59 67.59 153.60
5d_25C Five days - 25 degrees Celsius 156.34 93.73 218.96
7d_25C Seven days - 25 degrees Celsius 154.84 92.34 217.34
10d_25C Ten days - 25 degrees Celsius 206.65 122.08 291.22
7d_15C Seven days - 15 degrees Celsius 181.64 105.18 258.09
7d_30C Seven days - 30 degrees Celsius 144.68 86.84 202.52

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.121948 no
3d_25C 7d_25C 0.134450 no
3d_25C 7d_15C 0.027278 yes
3d_25C 7d_30C 0.248951 no
3d_25C 10d_25C 0.002297 yes
5d_25C 7d_25C 0.980631 no
5d_25C 7d_15C 0.591742 no
5d_25C 7d_30C 0.804070 no
5d_25C 10d_25C 0.230934 no
7d_25C 7d_15C 0.566980 no
7d_25C 7d_30C 0.832688 no
7d_25C 10d_25C 0.222604 no
7d_15C 7d_30C 0.369022 no
7d_15C 10d_25C 0.653539 no
7d_30C 10d_25C 0.107149 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7324.t1
MSIQENVESLPQYLGDDTRPTSKRELAGWYCYGWAAEVFVVCAMGSFLPITLEQMARDRGVLLSDKTTPCSATWR
PSLPSPGSDAPVYLPQVSDGGQCIIYFLGAEINTASFALYTFSLSVLVQAVLIISMSGAADHGTYRKKLLIVFAL
IGSIATMLFLVVVPKVYLLGGLLAIISNTCFGASFVLLNSFLPVLVRHHPSLKESEEATPSGGNVTSPRGNPLFS
STGDMDRTNMDDSTPLLGPNREATKTSASTITSLELRLSTRISSNGIGIGYIGAVILQVFSILVVVVVRSPTFSL
RLVLFLIGLWWFVFTIPAALWLRTRPGPPLLGSDGKPLHSWISYMAYAWKSLGKTIARARQLKDIVIFLAAWFLL
SDGIATVSGTAVLFAKTQLNMKPAALGLINVIVMLAGVFGAFTWSYISNFFNLRASQTIIACIILFELIPLYGLL
GFIPAVQRVGLGLHQPWEMYPLGAVYGLVMGGLSSYCRSFFGQLIPPGYEAAFYALYAITDKGSSIFGPAIVGAI
TDRYGEIRPAFGFLAILIIVPLPLMLLVDVDRGQRDALALGAELDGIPQRSEYGTISDDQTTGDPIEE*
Coding >Pro_DTO377G3_2|g7324.t1
ATGAGTATACAGGAGAATGTCGAGTCTCTCCCTCAATATCTTGGTGATGACACCCGGCCGACTAGCAAGAGGGAG
CTTGCTGGCTGGTATTGCTATGGCTGGGCTGCCGAGGTCTTTGTAGTCTGTGCCATGGGTTCATTTCTTCCGATA
ACGCTGGAGCAGATGGCTCGGGATCGGGGCGTTCTGCTGTCCGACAAAACGACACCATGCAGCGCAACCTGGAGA
CCCTCGCTGCCATCACCAGGCTCGGATGCACCGGTGTATCTTCCCCAGGTGTCAGATGGCGGCCAGTGCATCATT
TACTTCCTCGGCGCTGAAATCAACACGGCAAGCTTTGCCCTGTATACTTTTTCATTGAGCGTCTTAGTTCAGGCA
GTCCTGATAATTTCAATGTCAGGAGCCGCTGACCATGGAACCTATCGCAAGAAACTCTTGATTGTTTTTGCTCTC
ATCGGCTCAATTGCGACCATGTTGTTTTTGGTTGTGGTCCCCAAAGTTTACCTCCTAGGTGGACTGCTTGCAATC
ATTTCAAATACTTGCTTTGGTGCGTCTTTTGTCCTTTTGAATTCGTTTCTACCTGTTCTGGTCCGCCACCATCCA
TCGCTTAAGGAAAGTGAAGAGGCGACACCGTCAGGCGGTAATGTGACAAGCCCCAGGGGCAACCCTTTATTTTCT
TCGACCGGAGATATGGACCGAACAAACATGGATGACTCTACGCCGCTACTCGGGCCTAACAGAGAAGCCACAAAG
ACGTCTGCTTCCACTATCACTTCCCTAGAGCTTAGACTCTCCACCAGAATCTCGTCCAATGGCATCGGCATAGGC
TATATTGGTGCAGTGATTTTACAGGTGTTTTCTATCTTAGTTGTTGTGGTCGTGCGTTCACCAACATTCTCATTA
CGCCTTGTGCTCTTCTTGATTGGGCTATGGTGGTTTGTTTTTACCATCCCGGCAGCCTTGTGGCTGCGCACTCGG
CCAGGCCCACCTTTGTTGGGCAGTGACGGCAAACCGCTCCATTCGTGGATCTCATACATGGCATACGCCTGGAAA
TCTCTTGGAAAAACCATCGCGCGGGCGCGGCAGCTGAAAGATATCGTGATCTTCCTTGCTGCCTGGTTCCTTCTC
AGTGATGGAATTGCCACTGTCAGTGGCACTGCCGTACTATTTGCGAAAACCCAACTCAACATGAAGCCTGCCGCC
CTGGGACTGATCAATGTGATCGTCATGCTTGCAGGAGTATTCGGTGCATTCACCTGGAGCTACATATCGAATTTC
TTCAATCTCAGAGCCTCACAAACAATTATTGCGTGTATTATCTTGTTTGAGCTCATTCCACTGTATGGTCTTCTT
GGATTCATCCCGGCTGTGCAACGCGTGGGGCTTGGTCTCCACCAGCCTTGGGAAATGTATCCTTTGGGGGCCGTT
TATGGCCTTGTTATGGGTGGACTGTCATCATACTGTCGAAGCTTCTTCGGGCAACTCATCCCCCCTGGTTACGAA
GCGGCTTTCTACGCGCTTTATGCAATCACCGACAAAGGGTCTAGCATTTTTGGACCAGCTATTGTTGGCGCTATT
ACGGATCGCTACGGTGAGATTCGACCGGCGTTTGGGTTCTTGGCGATTTTGATTATTGTGCCACTACCACTTATG
CTTTTGGTGGATGTCGACCGCGGTCAACGAGATGCATTGGCGTTGGGAGCCGAATTGGATGGCATACCGCAAAGA
TCTGAGTATGGGACCATATCTGACGATCAAACCACGGGGGATCCGATTGAAGAGTGA
Transcript >Pro_DTO377G3_2|g7324.t1
ATGAGTATACAGGAGAATGTCGAGTCTCTCCCTCAATATCTTGGTGATGACACCCGGCCGACTAGCAAGAGGGAG
CTTGCTGGCTGGTATTGCTATGGCTGGGCTGCCGAGGTCTTTGTAGTCTGTGCCATGGGTTCATTTCTTCCGATA
ACGCTGGAGCAGATGGCTCGGGATCGGGGCGTTCTGCTGTCCGACAAAACGACACCATGCAGCGCAACCTGGAGA
CCCTCGCTGCCATCACCAGGCTCGGATGCACCGGTGTATCTTCCCCAGGTGTCAGATGGCGGCCAGTGCATCATT
TACTTCCTCGGCGCTGAAATCAACACGGCAAGCTTTGCCCTGTATACTTTTTCATTGAGCGTCTTAGTTCAGGCA
GTCCTGATAATTTCAATGTCAGGAGCCGCTGACCATGGAACCTATCGCAAGAAACTCTTGATTGTTTTTGCTCTC
ATCGGCTCAATTGCGACCATGTTGTTTTTGGTTGTGGTCCCCAAAGTTTACCTCCTAGGTGGACTGCTTGCAATC
ATTTCAAATACTTGCTTTGGTGCGTCTTTTGTCCTTTTGAATTCGTTTCTACCTGTTCTGGTCCGCCACCATCCA
TCGCTTAAGGAAAGTGAAGAGGCGACACCGTCAGGCGGTAATGTGACAAGCCCCAGGGGCAACCCTTTATTTTCT
TCGACCGGAGATATGGACCGAACAAACATGGATGACTCTACGCCGCTACTCGGGCCTAACAGAGAAGCCACAAAG
ACGTCTGCTTCCACTATCACTTCCCTAGAGCTTAGACTCTCCACCAGAATCTCGTCCAATGGCATCGGCATAGGC
TATATTGGTGCAGTGATTTTACAGGTGTTTTCTATCTTAGTTGTTGTGGTCGTGCGTTCACCAACATTCTCATTA
CGCCTTGTGCTCTTCTTGATTGGGCTATGGTGGTTTGTTTTTACCATCCCGGCAGCCTTGTGGCTGCGCACTCGG
CCAGGCCCACCTTTGTTGGGCAGTGACGGCAAACCGCTCCATTCGTGGATCTCATACATGGCATACGCCTGGAAA
TCTCTTGGAAAAACCATCGCGCGGGCGCGGCAGCTGAAAGATATCGTGATCTTCCTTGCTGCCTGGTTCCTTCTC
AGTGATGGAATTGCCACTGTCAGTGGCACTGCCGTACTATTTGCGAAAACCCAACTCAACATGAAGCCTGCCGCC
CTGGGACTGATCAATGTGATCGTCATGCTTGCAGGAGTATTCGGTGCATTCACCTGGAGCTACATATCGAATTTC
TTCAATCTCAGAGCCTCACAAACAATTATTGCGTGTATTATCTTGTTTGAGCTCATTCCACTGTATGGTCTTCTT
GGATTCATCCCGGCTGTGCAACGCGTGGGGCTTGGTCTCCACCAGCCTTGGGAAATGTATCCTTTGGGGGCCGTT
TATGGCCTTGTTATGGGTGGACTGTCATCATACTGTCGAAGCTTCTTCGGGCAACTCATCCCCCCTGGTTACGAA
GCGGCTTTCTACGCGCTTTATGCAATCACCGACAAAGGGTCTAGCATTTTTGGACCAGCTATTGTTGGCGCTATT
ACGGATCGCTACGGTGAGATTCGACCGGCGTTTGGGTTCTTGGCGATTTTGATTATTGTGCCACTACCACTTATG
CTTTTGGTGGATGTCGACCGCGGTCAACGAGATGCATTGGCGTTGGGAGCCGAATTGGATGGCATACCGCAAAGA
TCTGAGTATGGGACCATATCTGACGATCAAACCACGGGGGATCCGATTGAAGAGTGA
Gene >Pro_DTO377G3_2|g7324.t1
ATGAGTATACAGGAGAATGTCGAGTCTCTCCCTCAATATCTTGGTGATGACACCCGGCCGACTAGCAAGAGGGAG
CTTGCTGGCTGGTATTGCTATGGCTGGGCTGCCGAGGTCTTTGTAGTCTGTGCCATGGGTACGTGTGATTCTACT
TTCATAGATCTGTTTTTTGCATCTTCATCCTAGACTTTTTATCTGATCTGTGAAAGGTTCATTTCTTCCGATAAC
GCTGGAGCAGATGGCTCGGGATCGGGGCGTTCTGCTGTCCGACAAAACGACACCATGCAGCGCAACCTGGAGACC
CTCGCTGCCATCACCAGGCTCGGATGCACCGGTGTATCTTCCCCAGGTGTCAGATGGCGGCCAGTGCATCATTTA
CTTCCTCGGCGCTGAAATCAACACGGCAAGCTTTGCCCTGTATACTTTTTCATTGAGCGTCTTAGTTCAGGCAGT
CCTGATAATTTCAATGTCAGGAGCCGCTGACCATGGAACCTATCGCAAGAAACTCTTGATTGTTTTTGCTCTCAT
CGGCTCAATTGCGACCATGTTGTTTTTGGTTGTGGTCCCCAAAGTTTACCTCCTAGGTGGACTGCTTGCAATCAT
TTCAAATACTTGCTTTGGTGCGTCTTTTGTCCTTTTGAATTCGTTTCTACCTGTTCTGGTCCGCCACCATCCATC
GCTTAAGGAAAGTGAAGAGGCGACACCGTCAGGCGGTAATGTGACAAGCCCCAGGGGCAACCCTTTATTTTCTTC
GACCGGAGATATGGACCGAACAAACATGGATGACTCTACGCCGCTACTCGGGCCTAACAGAGAAGCCACAAAGAC
GTCTGCTTCCACTATCACTTCCCTAGAGCTTAGACTCTCCACCAGAATCTCGTCCAATGGCATCGGCATAGGCTA
TATTGGTGCAGTGATTTTACAGGTGTTTTCTATCTTAGTTGTTGTGGTCGTGCGTTCACCAACATTCTCATTACG
CCTTGTGCTCTTCTTGATTGGGCTATGGTGGTTTGTTTTTACCATCCCGGCAGCCTTGTGGCTGCGCACTCGGCC
AGGCCCACCTTTGTTGGGCAGTGACGGCAAACCGCTCCATTCGTGGATCTCATACATGGCATACGCCTGGAAATC
TCTTGGAAAAACCATCGCGCGGGCGCGGCAGCTGAAAGATATCGTGATCTTCCTTGCTGCCTGGTTCCTTCTCAG
TGATGGAATTGCCACTGTCAGTGGCACTGCCGTACTATTTGCGAAAACCCAACTCAACATGAAGCCTGCCGCCCT
GGGACTGATCAATGTGATCGTCATGCTTGCAGGAGTATTCGGTGCATTCACCTGGAGCTACATATCGAATTTCTT
CAATCTCAGAGCCTCACAAACAATTATTGCGTGTATTATCTTGTTTGAGCTCATTCCACTGTATGGTCTTCTTGG
ATTCATCCCGGCTGTGCAACGCGTGGGGCTTGGTCTCCACCAGCCTTGGGAAATGTATCCTTTGGGGGCCGTTTA
TGGCCTTGTTATGGGTGGACTGTCATCATACTGTCGAAGCTTCTTCGGGCAACTCATCCCCCCTGGTTACGAAGC
GGCTTTCTACGCGCTTTATGCAATCACCGACAAAGGGTCTAGCATTTTTGGACCAGCTATTGTTGGCGCTATTAC
GGATCGCTACGGTGAGATTCGACCGGCGTTTGGGTTCTTGGCGATTTTGATTATTGTGCCACTACCACTTATGCT
TTTGGTGGATGTCGACCGCGGTCAACGAGATGCATTGGCGTTGGGAGCCGAATTGGATGGCATACCGCAAAGATC
TGAGTATGGGACCATATCTGACGATCAAACCACGGGGGATCCGATTGAAGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail