Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7315.t1
Gene name
Locationscaffold_22:209073..211539
Strand-
Gene length (bp)2466
Transcript length (bp)2136
Coding sequence length (bp)2136
Protein length (aa) 712

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16420 ATG7_N Ubiquitin-like modifier-activating enzyme ATG7 N-terminus 5.6E-113 1 357
PF00899 ThiF ThiF family 4.4E-44 378 648

GO

GO Term Description Terminal node
GO:0008641 ubiquitin-like modifier activating enzyme activity Yes
GO:0016877 ligase activity, forming carbon-sulfur bonds No
GO:0016874 ligase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7315.t1
MQYAPFASDIELPFYTSLASHKINHDKLDDSARPVLGLYEIRPSDPEAASCRIQIHGNALTSSEVPAGYYRAEGM
IKNVNTVEEYRNMDRSKLLYQAGQMIWDAIHDGTILSCPSLLCSFVIVSFADLKKYKFHYWFAFPAIHSDPQWVP
VQPTDQVSQPHQDNSLDNLKGIHLSPHESTALVEAVETWSYMVDPRQRGFFLARKVRENSDNASSGDSETKNAQQ
GDTSNINWQIASLSEYENGFFKNVATEDRYFCFADPSNYEQAPGWMLRNLLVLIKQRWGIERVQLIRYRDVHARR
DQGRSTVIQLESSSKQETETPRSLQSQGSLPLPKVTGWERNSTGKLAGRIVNLTEYMDPKRLADQSVDLNLKLIK
WRISPTLDLEKIKNTKCLLLGAGTLGSYVSRNLLGWGVKKITFVDNGTVSFSNPVRQPLFNFEDCLNGGVQKALR
ASEALTQIYPGVDTKGYVFSVPMAGHPIVDEAATRADFDRLKTLIDEHDAIFLLMDTRESRWLPTVMGKAAGKIV
MNAALGFDSFVVMRHGIMEDENPAELGCYFCNDVVVPANSIKDQTLDQQCTVTRPGVAPIASALLVELFVSILQH
PRGAAAPAPIARNTERDDHPLGSVPHQIRGFLSNFENLSVTGKSYSSCSACSDKIVSAYREHGWDFVRKALNEHG
YVEELSGLREVHEKAEAALADIDWDEASDNEEIEIL*
Coding >Pro_DTO377G3_2|g7315.t1
ATGCAGTACGCACCGTTTGCCTCCGACATCGAATTACCCTTCTATACTTCACTGGCTTCCCATAAGATCAACCAT
GACAAACTAGATGATTCCGCCCGGCCTGTTCTGGGACTATATGAGATCCGTCCGTCTGATCCCGAAGCTGCGTCG
TGTCGTATTCAAATCCATGGGAACGCCCTAACCAGCAGCGAGGTCCCGGCTGGCTATTACAGAGCAGAGGGCATG
ATCAAAAATGTCAATACTGTTGAGGAATATCGAAACATGGACAGATCCAAACTGCTCTATCAAGCTGGACAAATG
ATATGGGATGCCATTCATGATGGAACCATTCTTTCTTGTCCCTCCTTACTCTGCAGTTTCGTGATTGTATCTTTT
GCAGACCTCAAAAAATACAAGTTCCACTACTGGTTTGCTTTCCCAGCAATCCATTCAGATCCTCAATGGGTCCCC
GTGCAACCAACAGACCAAGTATCCCAGCCACACCAGGATAATAGTCTTGACAACTTGAAGGGAATACACTTATCT
CCACATGAAAGCACTGCCTTGGTGGAGGCGGTGGAAACATGGTCATATATGGTGGATCCTCGACAACGAGGGTTT
TTTTTGGCTCGAAAAGTCAGAGAGAATTCCGATAACGCATCCTCAGGTGATTCCGAAACGAAGAATGCCCAACAA
GGCGACACTTCAAATATAAACTGGCAGATAGCGTCACTTTCCGAATATGAAAATGGGTTTTTCAAAAATGTCGCT
ACTGAAGACCGCTATTTCTGTTTCGCAGACCCATCAAATTATGAACAGGCCCCAGGATGGATGTTACGAAACCTG
CTTGTTCTGATCAAGCAGCGATGGGGGATCGAAAGGGTACAATTGATACGCTATCGCGACGTGCACGCGAGGCGT
GATCAAGGGCGCAGTACAGTAATTCAGCTGGAGTCAAGTTCAAAACAAGAGACTGAGACACCGAGATCACTGCAA
AGTCAAGGGTCGTTACCACTGCCAAAGGTGACCGGTTGGGAACGCAACTCGACTGGGAAATTAGCCGGGAGAATT
GTCAACCTTACAGAGTACATGGATCCTAAGAGATTGGCAGACCAGTCGGTTGATCTCAACCTCAAACTTATCAAA
TGGCGGATCAGCCCGACGCTCGATCTTGAAAAAATCAAGAACACGAAATGTCTATTGCTAGGGGCTGGCACATTA
GGCAGCTACGTCTCCCGAAATCTGCTGGGCTGGGGCGTGAAGAAGATCACTTTCGTCGACAATGGGACGGTTTCA
TTTTCTAACCCTGTTCGGCAGCCACTATTCAATTTCGAAGACTGCTTGAACGGTGGTGTCCAAAAAGCACTTCGA
GCATCCGAAGCCCTAACCCAAATTTACCCGGGAGTAGATACTAAAGGTTATGTGTTCTCGGTGCCCATGGCAGGC
CATCCTATTGTGGACGAAGCGGCGACCAGGGCAGATTTTGATCGTCTCAAGACACTGATTGATGAACATGATGCT
ATCTTCCTTCTCATGGATACCCGAGAATCGCGATGGCTGCCCACAGTGATGGGAAAGGCGGCTGGGAAAATTGTG
ATGAACGCAGCTCTAGGATTTGATTCCTTTGTGGTGATGCGCCATGGTATCATGGAGGATGAAAATCCAGCTGAG
CTTGGGTGCTATTTCTGCAACGATGTGGTAGTACCAGCTAATTCTATCAAAGATCAAACACTCGACCAGCAGTGT
ACAGTGACCCGCCCTGGAGTGGCTCCTATAGCCTCTGCACTTCTGGTGGAGCTTTTCGTGTCAATACTTCAGCAC
CCCCGAGGCGCTGCCGCACCAGCCCCCATTGCCCGAAATACTGAGCGTGATGATCACCCCTTAGGAAGTGTGCCC
CATCAAATACGAGGGTTTCTCTCTAATTTCGAGAACTTGTCTGTCACCGGCAAAAGTTATTCGAGCTGCAGTGCA
TGCTCAGATAAAATTGTCAGTGCATACCGCGAGCACGGTTGGGACTTTGTGCGAAAAGCCTTGAACGAACATGGC
TATGTCGAAGAATTGAGTGGACTAAGAGAGGTTCATGAGAAGGCGGAAGCAGCACTAGCCGATATTGACTGGGAC
GAGGCATCTGACAACGAGGAGATCGAGATCCTTTAG
Transcript >Pro_DTO377G3_2|g7315.t1
ATGCAGTACGCACCGTTTGCCTCCGACATCGAATTACCCTTCTATACTTCACTGGCTTCCCATAAGATCAACCAT
GACAAACTAGATGATTCCGCCCGGCCTGTTCTGGGACTATATGAGATCCGTCCGTCTGATCCCGAAGCTGCGTCG
TGTCGTATTCAAATCCATGGGAACGCCCTAACCAGCAGCGAGGTCCCGGCTGGCTATTACAGAGCAGAGGGCATG
ATCAAAAATGTCAATACTGTTGAGGAATATCGAAACATGGACAGATCCAAACTGCTCTATCAAGCTGGACAAATG
ATATGGGATGCCATTCATGATGGAACCATTCTTTCTTGTCCCTCCTTACTCTGCAGTTTCGTGATTGTATCTTTT
GCAGACCTCAAAAAATACAAGTTCCACTACTGGTTTGCTTTCCCAGCAATCCATTCAGATCCTCAATGGGTCCCC
GTGCAACCAACAGACCAAGTATCCCAGCCACACCAGGATAATAGTCTTGACAACTTGAAGGGAATACACTTATCT
CCACATGAAAGCACTGCCTTGGTGGAGGCGGTGGAAACATGGTCATATATGGTGGATCCTCGACAACGAGGGTTT
TTTTTGGCTCGAAAAGTCAGAGAGAATTCCGATAACGCATCCTCAGGTGATTCCGAAACGAAGAATGCCCAACAA
GGCGACACTTCAAATATAAACTGGCAGATAGCGTCACTTTCCGAATATGAAAATGGGTTTTTCAAAAATGTCGCT
ACTGAAGACCGCTATTTCTGTTTCGCAGACCCATCAAATTATGAACAGGCCCCAGGATGGATGTTACGAAACCTG
CTTGTTCTGATCAAGCAGCGATGGGGGATCGAAAGGGTACAATTGATACGCTATCGCGACGTGCACGCGAGGCGT
GATCAAGGGCGCAGTACAGTAATTCAGCTGGAGTCAAGTTCAAAACAAGAGACTGAGACACCGAGATCACTGCAA
AGTCAAGGGTCGTTACCACTGCCAAAGGTGACCGGTTGGGAACGCAACTCGACTGGGAAATTAGCCGGGAGAATT
GTCAACCTTACAGAGTACATGGATCCTAAGAGATTGGCAGACCAGTCGGTTGATCTCAACCTCAAACTTATCAAA
TGGCGGATCAGCCCGACGCTCGATCTTGAAAAAATCAAGAACACGAAATGTCTATTGCTAGGGGCTGGCACATTA
GGCAGCTACGTCTCCCGAAATCTGCTGGGCTGGGGCGTGAAGAAGATCACTTTCGTCGACAATGGGACGGTTTCA
TTTTCTAACCCTGTTCGGCAGCCACTATTCAATTTCGAAGACTGCTTGAACGGTGGTGTCCAAAAAGCACTTCGA
GCATCCGAAGCCCTAACCCAAATTTACCCGGGAGTAGATACTAAAGGTTATGTGTTCTCGGTGCCCATGGCAGGC
CATCCTATTGTGGACGAAGCGGCGACCAGGGCAGATTTTGATCGTCTCAAGACACTGATTGATGAACATGATGCT
ATCTTCCTTCTCATGGATACCCGAGAATCGCGATGGCTGCCCACAGTGATGGGAAAGGCGGCTGGGAAAATTGTG
ATGAACGCAGCTCTAGGATTTGATTCCTTTGTGGTGATGCGCCATGGTATCATGGAGGATGAAAATCCAGCTGAG
CTTGGGTGCTATTTCTGCAACGATGTGGTAGTACCAGCTAATTCTATCAAAGATCAAACACTCGACCAGCAGTGT
ACAGTGACCCGCCCTGGAGTGGCTCCTATAGCCTCTGCACTTCTGGTGGAGCTTTTCGTGTCAATACTTCAGCAC
CCCCGAGGCGCTGCCGCACCAGCCCCCATTGCCCGAAATACTGAGCGTGATGATCACCCCTTAGGAAGTGTGCCC
CATCAAATACGAGGGTTTCTCTCTAATTTCGAGAACTTGTCTGTCACCGGCAAAAGTTATTCGAGCTGCAGTGCA
TGCTCAGATAAAATTGTCAGTGCATACCGCGAGCACGGTTGGGACTTTGTGCGAAAAGCCTTGAACGAACATGGC
TATGTCGAAGAATTGAGTGGACTAAGAGAGGTTCATGAGAAGGCGGAAGCAGCACTAGCCGATATTGACTGGGAC
GAGGCATCTGACAACGAGGAGATCGAGATCCTTTAG
Gene >Pro_DTO377G3_2|g7315.t1
ATGCAGTACGCACCGTTTGCCTCCGACATCGAATTACCCTTCTATACTTCACTGGCTTCCCATAAGATCAACCAT
GACAAACTAGATGATTCCGCCCGGCCTGTTCTGGGACTATATGAGATCCGTCCGTCTGATCCCGAAGCTGCGTCG
TGTCGTATTCAAATCCATGGGAACGCCCTAACCAGCAGCGAGTAAGATAAAAGAAAATATCCCTGAAAGCCCTTC
TAACAGCGACCTAGGGTCCCGGCTGGCTATTACAGAGCAGAGGGCATGATCAAAAATGTCAATACTGTTGAGGAA
TATCGAAACATGGACAGATCCAAACTGCTCTATCAAGCTGGACAAATGGTAGGAATCAACATTAGCCAGATACCT
TAGAGAGAGATACTAATCAACTCCAGATATGGGATGCCATTCATGATGGAACCATTCTTTCTTGTCCCTCCTTAC
TCTGCAGTTTCGTGATTGTATCTTTTGCAGACCTCAAAAAATACAAGTTCCACTACTGGTTTGCTTTCCCAGCAA
TCCATTCAGATCCTCAATGGGTCCCCGTGCAACCAACAGACCAAGTATCCCAGCCACACCAGGATAATAGTCTTG
ACAACTTGAAGGGAATACACTTATCTCCACATGAAAGCACTGCCTTGGTGGAGGCGGTGGAAACATGGTCATATA
TGGTGGATCCTCGACAACGAGGGTTTTTTTTGGCTCGAAAAGTCAGAGAGAATTCCGATAACGCATCCTCAGGTG
ATTCCGAAACGAAGAATGCCCAACAAGGCGACACTTCAAATATAAACTGGCAGATAGCGTCACTTTCCGAATATG
AAAATGGGTTTTTCAAAAATGTCGCTACTGAAGACCGCTATTTCTGTTTCGCAGACCCATCAAATTATGAACAGG
CCCCAGGATGGATGTTACGAAACCTGCTTGTTCTGATCAAGCAGCGATGGGGGATCGAAAGGGTACAATTGATAC
GCTATCGCGACGTGCACGCGAGGCGTGATCAAGGGCGCAGTACAGTAATTCAGCTGGAGTCAAGTTCAAAACAAG
AGACTGAGACACCGAGATCACTGCAAAGTCAAGGGTCGTTACCACTGCCAAAGGTGACCGGTTGGGAACGCAACT
CGACTGGGAAATTAGCCGGGAGAATTGTCAACCTTACAGAGTACATGGATCCTAAGAGGTATGGCATTAATTTGG
AGATAACCAAACTGAATGAAGACTTGATCAAGCATGCTAATTTTATTACTGAAGATTGGCAGACCAGTCGGTTGA
TCTCAACCTCAAACTTATCAAATGGCGGATCAGCCCGACGCTCGATCTTGAAAAAATCAAGAACACGAAATGTCT
ATTGCTAGGGGCTGGCACATTAGGCAGCTACGTCTCCCGAAATCTGCTGGTATGTGGACGTCAACTTCCCTGCCG
AAAATTTGTTCTAATCATCCACTACATAGGGCTGGGGCGTGAAGAAGATCACTTTCGTCGACAATGGGACGGTTT
CATTTTCTAACCCTGTTCGGCAGCCACTATTCAATTTCGAAGACTGCTTGAACGGTGGTGTCCAAAAAGCACTTC
GAGCATCCGAAGCCCTAACCCAAATTTACCCGGGAGTAGATACTAAAGGTTATGTGTTCTCGGTGCCCATGGCAG
GCCATCCTATTGTGGACGAAGCGGCGACCAGGGCAGATTTTGATCGTCTCAAGACACTGATTGATGAACATGATG
CTATCTTCCTTCTCATGGATACCCGAGAATCGCGATGGCTGCCCACAGTGATGGGAAAGGCGGCTGGGAAAATTG
TGATGAACGCAGCTCTAGGATTTGATTCCTTTGTGGTGATGCGCCATGGTATCATGGAGGATGAAAATCCAGCTG
AGCTTGGGTGCTATTTCTGCAACGATGTGGTAGTACCAGCTAATGTAAGATTATCCAAAGAAGGGACCTGCTTTA
TACAGAACTGACTGCGGAATAGTCTATCAAAGATCAAACACTCGACCAGCAGTGTACAGTGACCCGCCCTGGAGT
GGCTCCTATAGCCTCTGCACTTCTGGTGGAGCTTTTCGTGTCAATACTTCAGCACCCCCGAGGCGCTGCCGCACC
AGCCCCCATTGCCCGAAATACTGAGCGTGATGATCACCCCTTAGGAAGTGTGCCCCATCAAATACGAGGGTTTCT
CTCTAATTTCGAGAACTTGTCTGTCACCGGCAAAAGTTATTCGAGCTGCAGTGCATGCTCAGATAAAATTGTCAG
TGCATACCGCGAGCACGGTTGGGACTTTGTGCGAAAAGCCTTGAACGAACATGGCTATGTCGAAGAATTGAGTGG
ACTAAGAGAGGTCAGTCGATGACTACAAAACGACTTGATCCCAAACTGACGAATATGAAGGTTCATGAGAAGGCG
GAAGCAGCACTAGCCGATATTGACTGGGACGAGGCATCTGACAACGAGGAGATCGAGATCCTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail