Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7308.t1
Gene name
Locationscaffold_22:194791..197415
Strand-
Gene length (bp)2624
Transcript length (bp)2343
Coding sequence length (bp)2343
Protein length (aa) 781

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 1.1E-39 303 777
PF17807 zf-UBP_var Variant UBP zinc finger 1.2E-22 13 78
PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein 1.8E-18 176 249
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 2.5E-17 399 759
PF00627 UBA UBA/TS-N domain 1.4E-09 586 619

GO

GO Term Description Terminal node
GO:0016579 protein deubiquitination Yes
GO:0008270 zinc ion binding Yes
GO:0036459 thiol-dependent ubiquitinyl hydrolase activity Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008234 cysteine-type peptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0071704 organic substance metabolic process No
GO:0006508 proteolysis No
GO:0019783 ubiquitin-like protein-specific protease activity No
GO:0044260 cellular macromolecule metabolic process No
GO:0036211 protein modification process No
GO:0003824 catalytic activity No
GO:0101005 ubiquitinyl hydrolase activity No
GO:0006464 cellular protein modification process No
GO:0046872 metal ion binding No
GO:0044238 primary metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0046914 transition metal ion binding No
GO:0008152 metabolic process No
GO:0016787 hydrolase activity No
GO:0070646 protein modification by small protein removal No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0044267 cellular protein metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0008233 peptidase activity No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0005488 binding No
GO:0019538 protein metabolic process No
GO:0043169 cation binding No
GO:0044237 cellular metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7308.t1
MASCVHTGAADLNPPGPYQAVYREDCTQCFDSIDDDAGLNVCLNCFNGGCAGNRDHALLHYKRFGHPLALNIRRT
PKKVQRDEPPPKISKLSIAAETEEDRYDIATSVVCYSCPQDNVDKASGKLPAVIEGVMTAMTFSRKEEVKAWEQE
FVPCEHTLCLVQQDNTHAASTDLNHCSECDLGENLWLCLECGNKGCGRSQFGGSKGNSHGLTHADSTSHAVAVKL
GSITAEGSADVYCYKCNEERVDPELATHLAHWGIYLAGREKTEKSLMEMQVEHNLKWEFSMTTEDGRELVPVFGP
AFTGLANLGNSCYLSSIMQCIFSVAGFRERYYQLSEEPPLCQAPAQDLETQLRKLADGLLSGRYSRPDSRVMLSA
DIPEVAHQKGLAPAMFKYLIGQGHEEFSTMRQQDAFEFLLHLFKSVSLSKHTSPQINPVQDFRFQVEQRLQCLHC
KKVRYKVDEQDNVSVAVPARPITSSDGTGKEYESVDLSECLDIFTSAEVVELTCPACGSQDGFSKQSSFKTLPQE
LVVNARRFELVNWVPTKLDIPVLVDDKPLDFSSYLAGEHDAGEEQLPDIEESTAFVPNPGALDQLIGMGFPAVRC
EKALHATGNSDPETAMNWLFAHMEDPDIDEPMALEPVGTSSSNEQDAAKIAQLGDMGIEAPRAQRALAATDGDVN
RALDWVFTHSDDVVEMETPSIDDHNAQSHGGSVGLTSLPARYELRSIVCHKGTSVHAGHYVAMIRKQLPGQSGLS
WVMFNDEKVVKFEDIEAMKKTAYLYFFTRI*
Coding >Pro_DTO377G3_2|g7308.t1
ATGGCCTCTTGTGTCCATACCGGTGCTGCGGATCTGAATCCGCCAGGACCTTACCAGGCTGTTTATCGAGAAGAT
TGTACTCAGTGCTTTGATTCTATTGACGATGATGCTGGTCTAAATGTCTGTCTGAATTGCTTCAATGGTGGATGT
GCTGGAAACAGAGACCATGCCCTGCTTCATTACAAGAGATTTGGCCATCCACTGGCTTTGAACATACGAAGGACT
CCTAAGAAAGTGCAGCGCGACGAGCCCCCGCCGAAGATTTCAAAGCTTTCCATCGCAGCCGAAACGGAAGAGGAT
AGATATGACATTGCTACGTCAGTGGTGTGCTATTCATGCCCCCAAGACAATGTGGACAAAGCCAGTGGCAAGCTC
CCTGCTGTCATTGAAGGTGTTATGACAGCAATGACTTTCTCAAGAAAGGAAGAAGTCAAGGCATGGGAGCAAGAG
TTTGTGCCTTGCGAGCATACATTGTGTCTGGTTCAACAGGACAACACGCATGCCGCATCGACTGATTTAAACCAT
TGTTCAGAGTGTGACCTGGGAGAGAACCTCTGGCTGTGTCTGGAATGTGGGAATAAGGGTTGTGGGCGAAGTCAA
TTCGGTGGAAGCAAGGGAAACTCCCATGGGCTTACTCATGCAGACTCAACATCACATGCTGTGGCTGTCAAGCTT
GGCTCCATCACAGCAGAAGGCTCTGCTGATGTCTACTGTTATAAGTGCAACGAAGAAAGAGTAGACCCAGAACTA
GCGACCCACCTTGCGCACTGGGGAATCTATTTGGCTGGGCGTGAGAAGACAGAGAAGAGTCTGATGGAGATGCAG
GTCGAGCATAATCTAAAATGGGAATTTTCCATGACGACCGAGGATGGCCGGGAGCTGGTCCCTGTCTTTGGGCCT
GCATTTACAGGTCTGGCGAATCTTGGCAACAGCTGCTATCTCTCCAGTATCATGCAATGCATATTTTCTGTGGCC
GGATTTCGTGAGCGATACTATCAGCTGTCAGAAGAACCACCACTCTGCCAAGCACCAGCACAGGACCTTGAGACA
CAATTGCGAAAACTTGCCGACGGTCTACTCTCAGGCCGGTACTCTCGGCCTGATTCTCGCGTTATGTTGTCCGCG
GATATACCAGAAGTCGCTCATCAGAAGGGTTTAGCACCAGCAATGTTCAAGTATCTTATTGGCCAAGGTCATGAG
GAGTTCTCAACTATGAGACAGCAAGATGCATTTGAATTCCTCCTTCATTTATTCAAGTCTGTCAGCCTATCGAAA
CACACCAGTCCGCAGATTAACCCGGTCCAGGACTTTCGCTTCCAGGTTGAGCAGCGTCTTCAGTGCTTGCATTGC
AAAAAAGTCCGCTATAAAGTGGATGAGCAAGATAACGTTTCGGTTGCTGTCCCCGCACGTCCTATTACCAGTTCT
GACGGAACAGGAAAGGAATATGAGTCTGTGGATTTGTCAGAGTGTCTAGACATCTTTACTTCGGCGGAGGTCGTT
GAGCTTACCTGTCCTGCTTGTGGCAGCCAAGATGGCTTTTCGAAGCAGTCGTCTTTCAAAACATTGCCTCAGGAA
TTAGTGGTCAATGCTCGTCGGTTTGAGCTCGTCAACTGGGTTCCGACAAAGTTGGATATCCCTGTGCTGGTCGAC
GACAAACCACTGGATTTCAGCTCTTACCTTGCTGGTGAGCATGATGCGGGTGAGGAGCAACTTCCCGATATTGAA
GAATCTACCGCATTTGTCCCGAATCCAGGAGCCCTCGATCAACTCATAGGCATGGGTTTCCCTGCTGTGAGGTGT
GAGAAAGCTCTTCATGCCACTGGCAACTCTGATCCGGAAACTGCCATGAATTGGCTATTTGCCCACATGGAAGAT
CCAGACATCGATGAACCGATGGCCCTTGAACCAGTCGGCACCTCCAGTTCTAATGAGCAAGACGCGGCAAAAATC
GCTCAATTAGGGGACATGGGTATTGAGGCGCCTCGTGCCCAGCGAGCCTTGGCCGCGACCGACGGTGATGTTAAC
AGGGCACTGGATTGGGTTTTCACTCACTCAGATGATGTGGTGGAAATGGAAACACCGAGTATCGACGACCACAAC
GCACAGTCTCATGGTGGCTCGGTTGGGCTTACTAGCCTACCTGCTCGATATGAATTAAGGTCAATTGTATGCCAC
AAAGGCACATCTGTCCATGCAGGGCATTATGTTGCCATGATTCGCAAACAATTGCCAGGTCAAAGTGGCCTGTCA
TGGGTGATGTTCAATGATGAAAAAGTTGTCAAGTTTGAAGATATCGAAGCGATGAAGAAAACCGCATATCTTTAC
TTCTTCACAAGGATCTAG
Transcript >Pro_DTO377G3_2|g7308.t1
ATGGCCTCTTGTGTCCATACCGGTGCTGCGGATCTGAATCCGCCAGGACCTTACCAGGCTGTTTATCGAGAAGAT
TGTACTCAGTGCTTTGATTCTATTGACGATGATGCTGGTCTAAATGTCTGTCTGAATTGCTTCAATGGTGGATGT
GCTGGAAACAGAGACCATGCCCTGCTTCATTACAAGAGATTTGGCCATCCACTGGCTTTGAACATACGAAGGACT
CCTAAGAAAGTGCAGCGCGACGAGCCCCCGCCGAAGATTTCAAAGCTTTCCATCGCAGCCGAAACGGAAGAGGAT
AGATATGACATTGCTACGTCAGTGGTGTGCTATTCATGCCCCCAAGACAATGTGGACAAAGCCAGTGGCAAGCTC
CCTGCTGTCATTGAAGGTGTTATGACAGCAATGACTTTCTCAAGAAAGGAAGAAGTCAAGGCATGGGAGCAAGAG
TTTGTGCCTTGCGAGCATACATTGTGTCTGGTTCAACAGGACAACACGCATGCCGCATCGACTGATTTAAACCAT
TGTTCAGAGTGTGACCTGGGAGAGAACCTCTGGCTGTGTCTGGAATGTGGGAATAAGGGTTGTGGGCGAAGTCAA
TTCGGTGGAAGCAAGGGAAACTCCCATGGGCTTACTCATGCAGACTCAACATCACATGCTGTGGCTGTCAAGCTT
GGCTCCATCACAGCAGAAGGCTCTGCTGATGTCTACTGTTATAAGTGCAACGAAGAAAGAGTAGACCCAGAACTA
GCGACCCACCTTGCGCACTGGGGAATCTATTTGGCTGGGCGTGAGAAGACAGAGAAGAGTCTGATGGAGATGCAG
GTCGAGCATAATCTAAAATGGGAATTTTCCATGACGACCGAGGATGGCCGGGAGCTGGTCCCTGTCTTTGGGCCT
GCATTTACAGGTCTGGCGAATCTTGGCAACAGCTGCTATCTCTCCAGTATCATGCAATGCATATTTTCTGTGGCC
GGATTTCGTGAGCGATACTATCAGCTGTCAGAAGAACCACCACTCTGCCAAGCACCAGCACAGGACCTTGAGACA
CAATTGCGAAAACTTGCCGACGGTCTACTCTCAGGCCGGTACTCTCGGCCTGATTCTCGCGTTATGTTGTCCGCG
GATATACCAGAAGTCGCTCATCAGAAGGGTTTAGCACCAGCAATGTTCAAGTATCTTATTGGCCAAGGTCATGAG
GAGTTCTCAACTATGAGACAGCAAGATGCATTTGAATTCCTCCTTCATTTATTCAAGTCTGTCAGCCTATCGAAA
CACACCAGTCCGCAGATTAACCCGGTCCAGGACTTTCGCTTCCAGGTTGAGCAGCGTCTTCAGTGCTTGCATTGC
AAAAAAGTCCGCTATAAAGTGGATGAGCAAGATAACGTTTCGGTTGCTGTCCCCGCACGTCCTATTACCAGTTCT
GACGGAACAGGAAAGGAATATGAGTCTGTGGATTTGTCAGAGTGTCTAGACATCTTTACTTCGGCGGAGGTCGTT
GAGCTTACCTGTCCTGCTTGTGGCAGCCAAGATGGCTTTTCGAAGCAGTCGTCTTTCAAAACATTGCCTCAGGAA
TTAGTGGTCAATGCTCGTCGGTTTGAGCTCGTCAACTGGGTTCCGACAAAGTTGGATATCCCTGTGCTGGTCGAC
GACAAACCACTGGATTTCAGCTCTTACCTTGCTGGTGAGCATGATGCGGGTGAGGAGCAACTTCCCGATATTGAA
GAATCTACCGCATTTGTCCCGAATCCAGGAGCCCTCGATCAACTCATAGGCATGGGTTTCCCTGCTGTGAGGTGT
GAGAAAGCTCTTCATGCCACTGGCAACTCTGATCCGGAAACTGCCATGAATTGGCTATTTGCCCACATGGAAGAT
CCAGACATCGATGAACCGATGGCCCTTGAACCAGTCGGCACCTCCAGTTCTAATGAGCAAGACGCGGCAAAAATC
GCTCAATTAGGGGACATGGGTATTGAGGCGCCTCGTGCCCAGCGAGCCTTGGCCGCGACCGACGGTGATGTTAAC
AGGGCACTGGATTGGGTTTTCACTCACTCAGATGATGTGGTGGAAATGGAAACACCGAGTATCGACGACCACAAC
GCACAGTCTCATGGTGGCTCGGTTGGGCTTACTAGCCTACCTGCTCGATATGAATTAAGGTCAATTGTATGCCAC
AAAGGCACATCTGTCCATGCAGGGCATTATGTTGCCATGATTCGCAAACAATTGCCAGGTCAAAGTGGCCTGTCA
TGGGTGATGTTCAATGATGAAAAAGTTGTCAAGTTTGAAGATATCGAAGCGATGAAGAAAACCGCATATCTTTAC
TTCTTCACAAGGATCTAG
Gene >Pro_DTO377G3_2|g7308.t1
ATGGCCTCTTGTGTCCATACCGGTGCTGCGGGTTTGTGACATCACCTTGATAATCGAAGAACAAATGGAGCTAAT
GGACAACACTCCATAGATCTGAATCCGCCAGGACCTTACCAGGCTGTTTATCGAGAAGATTGTACTCAGTGCTTT
GATTCTATTGTATGCCACCCCGGTTCCTACCACTCCACATGTCGTCTGACTAACCTTGCAAGGACGATGATGCTG
GTCTAAATGTCTGTCTGAATTGCTTCAATGGTGGATGTGCTGGAAACAGAGACCATGCCCTGCTTCATTACAAGA
GATTTGGCCATCCACTGGCTTTGAACATACGAAGGACTCCTAAGAAAGTGCAGGTACAGCCTCTAAACATTTCTT
GGACTTGTGGCCAATGATTCTCACACCTCTGATTTATAGCGCGACGAGCCCCCGCCGAAGATTTCAAAGCTTTCC
ATCGCAGCCGAAACGGAAGAGGATAGATATGACATTGCTACGTCAGTGGTGTGCTATTCATGCCCCCAAGACAAT
GTGGACAAAGCCAGTGGCAAGCTCCCTGCTGTCATTGAAGGTGTTATGACAGCAATGACTTTCTCAAGAAAGGAA
GAAGTCAAGGCATGGGAGCAAGAGTTTGTGCCTTGCGAGCATACATTGTGTCTGGTTCAACAGGACAACACGCAT
GCCGCATCGACTGGTATTGATTCCCTGAAATACTCAACTGGGGTCTGGGCTAATGAAATTGCAGATTTAAACCAT
TGTTCAGAGTGTGACCTGGGAGAGAACCTCTGGCTGTGTCTGGAATGTGGGAATAAGGGTTGTGGGCGAAGTCAA
TTCGGTGGAAGCAAGGGAAACTCCCATGGGCTTACTCATGCAGACTCAACATCACATGCTGTGGCTGTCAAGCTT
GGCTCCATCACAGCAGAAGGCTCTGCTGATGTCTACTGTTATAAGTGCAACGAAGAAAGAGTAGACCCAGAACTA
GCGACCCACCTTGCGCACTGGGGAATCTATTTGGCTGGGCGTGAGAAGACAGAGAAGAGTCTGATGGAGATGCAG
GTCGAGCATAATCTAAAATGGGAATTTTCCATGACGACCGAGGATGGCCGGGAGCTGGTCCCTGTCTTTGGGCCT
GCATTTACAGGTCTGGCGAATCTTGGCAACAGCTGCTATCTCTCCAGTATCATGCAATGCATATTTTCTGTGGCC
GGATTTCGTGAGCGATACTATCAGCTGTCAGAAGAACCACCACTCTGCCAAGCACCAGCACAGGACCTTGAGACA
CAATTGCGAAAACTTGCCGACGGTCTACTCTCAGGCCGGTACTCTCGGCCTGATTCTCGCGTTATGTTGTCCGCG
GATATACCAGAAGTCGCTCATCAGAAGGGTTTAGCACCAGCAATGTTCAAGTATCTTATTGGCCAAGGTCATGAG
GAGTTCTCAACTATGAGACAGCAAGATGCATTTGAATTCCTCCTTCATTTATTCAAGTCTGTCAGCCTATCGAAA
CACACCAGTCCGCAGATTAACCCGGTCCAGGACTTTCGCTTCCAGGTTGAGCAGCGTCTTCAGTGCTTGCATTGC
AAAAAAGTCCGCTATAAAGTGGATGAGCAAGATAACGTTTCGGTTGCTGTCCCCGCACGTCCTATTACCAGTTCT
GACGGAACAGGAAAGGAATATGAGTCTGTGGATTTGTCAGAGTGTCTAGACATCTTTACTTCGGCGGAGGTCGTT
GAGCTTACCTGTCCTGCTTGTGGCAGCCAAGATGGCTTTTCGAAGCAGTCGTCTTTCAAAACATTGCCTCAGGAA
TTAGTGGTCAATGCTCGTCGGTTTGAGCTCGTCAACTGGGTTCCGACAAAGTTGGATATCCCTGTGCTGGTCGAC
GACAAACCACTGGATTTCAGCTCTTACCTTGCTGGTGAGCATGATGCGGGTGAGGAGCAACTTCCCGATATTGAA
GAATCTACCGCATTTGTCCCGAATCCAGGAGCCCTCGATCAACTCATAGGCATGGGTTTCCCTGCTGTGAGGTGT
GAGAAAGCTCTTCATGCCACTGGCAACTCTGATCCGGAAACTGCCATGAATTGGCTATTTGCCCACATGGAAGAT
CCAGACATCGATGAACCGATGGCCCTTGAACCAGTCGGCACCTCCAGTTCTAATGAGCAAGACGCGGCAAAAATC
GCTCAATTAGGGGACATGGGTATTGAGGCGCCTCGTGCCCAGCGAGCCTTGGCCGCGACCGACGGTGATGTTAAC
AGGGCACTGGATTGGGTTTTCACTCACTCAGATGATGTGGTGGAAATGGAAACACCGAGTATCGACGACCACAAC
GCACAGTCTCATGGTGGCTCGGTTGGGCTTACTAGCCTACCTGCTCGATATGAATTAAGGTCAATTGTATGCCAC
AAAGGCACATCTGTCCATGCAGGGTGAGTGGCTCTATGTCTTCGTTCTCACTTCGTTGGGTTAGACTAACACATG
CTAGGCATTATGTTGCCATGATTCGCAAACAATTGCCAGGTCAAAGTGGCCTGTCATGGGTGATGTTCAATGATG
AAAAAGTTGTCAAGTTTGAAGATATCGAAGCGATGAAGAAAACCGCATATCTTTACTTCTTCACAAGGATCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail