© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Pro_DTO377G3_2|g7305.t1 |
| Gene name | |
| Location | scaffold_22:187668..188055 |
| Strand | + |
| Gene length (bp) | 387 |
| Transcript length (bp) | 225 |
| Coding sequence length (bp) | 225 |
| Protein length (aa) | 75 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF01194 | RNA_pol_N | RNA polymerases N / 8 kDa subunit | 2.8E-29 | 2 | 59 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0003899 | DNA-directed 5'-3' RNA polymerase activity | Yes |
| GO:0006351 | transcription, DNA-templated | Yes |
| GO:0003677 | DNA binding | Yes |
| GO:1901360 | organic cyclic compound metabolic process | No |
| GO:0034641 | cellular nitrogen compound metabolic process | No |
| GO:0005488 | binding | No |
| GO:0008152 | metabolic process | No |
| GO:0019438 | aromatic compound biosynthetic process | No |
| GO:0043170 | macromolecule metabolic process | No |
| GO:0016740 | transferase activity | No |
| GO:0003676 | nucleic acid binding | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0009058 | biosynthetic process | No |
| GO:0008150 | biological_process | No |
| GO:0006725 | cellular aromatic compound metabolic process | No |
| GO:0034654 | nucleobase-containing compound biosynthetic process | No |
| GO:0032774 | RNA biosynthetic process | No |
| GO:0016772 | transferase activity, transferring phosphorus-containing groups | No |
| GO:0016070 | RNA metabolic process | No |
| GO:0006139 | nucleobase-containing compound metabolic process | No |
| GO:0044271 | cellular nitrogen compound biosynthetic process | No |
| GO:0003824 | catalytic activity | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0140640 | catalytic activity, acting on a nucleic acid | No |
| GO:0044238 | primary metabolic process | No |
| GO:0034062 | 5'-3' RNA polymerase activity | No |
| GO:1901576 | organic substance biosynthetic process | No |
| GO:0009059 | macromolecule biosynthetic process | No |
| GO:0009987 | cellular process | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0090304 | nucleic acid metabolic process | No |
| GO:0016779 | nucleotidyltransferase activity | No |
| GO:0097747 | RNA polymerase activity | No |
| GO:0097659 | nucleic acid-templated transcription | No |
| GO:0140098 | catalytic activity, acting on RNA | No |
| GO:0018130 | heterocycle biosynthetic process | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0044249 | cellular biosynthetic process | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:1901362 | organic cyclic compound biosynthetic process | No |
| GO:0003674 | molecular_function | No |
| GO:0046483 | heterocycle metabolic process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 16 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| 3d_25C | Three days - 25 degrees Celsius | 367.50 | 163.86 | 571.13 |
| 5d_25C | Five days - 25 degrees Celsius | 223.62 | 86.99 | 360.25 |
| 7d_25C | Seven days - 25 degrees Celsius | 212.95 | 80.60 | 345.31 |
| 10d_25C | Ten days - 25 degrees Celsius | 157.48 | 54.91 | 260.05 |
| 7d_15C | Seven days - 15 degrees Celsius | 252.20 | 99.37 | 405.02 |
| 7d_30C | Seven days - 30 degrees Celsius | 259.64 | 106.18 | 413.11 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| 3d_25C | 5d_25C | 0.130632 | no |
| 3d_25C | 7d_25C | 0.089066 | no |
| 3d_25C | 7d_15C | 0.287707 | no |
| 3d_25C | 7d_30C | 0.321716 | no |
| 3d_25C | 10d_25C | 0.007437 | yes |
| 5d_25C | 7d_25C | 0.926353 | no |
| 5d_25C | 7d_15C | 0.796143 | no |
| 5d_25C | 7d_30C | 0.732058 | no |
| 5d_25C | 10d_25C | 0.354112 | no |
| 7d_25C | 7d_15C | 0.701493 | no |
| 7d_25C | 7d_30C | 0.631404 | no |
| 7d_25C | 10d_25C | 0.439798 | no |
| 7d_15C | 7d_30C | 0.957220 | no |
| 7d_15C | 10d_25C | 0.190552 | no |
| 7d_30C | 10d_25C | 0.139728 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Pro_DTO377G3_2|g7305.t1 MIIPVRCFSCGKVVGDLWERYLQLLDDGVPDGDAMDQLGCRRYCCRRMVMTHVDLIEKLLRYNSAEKDRSKAQV* |
| Coding | >Pro_DTO377G3_2|g7305.t1 ATGATTATTCCTGTCCGTTGTTTCTCCTGTGGCAAGGTTGTCGGTGACCTCTGGGAGCGTTACCTGCAGCTCTTG GACGACGGTGTTCCAGATGGCGATGCTATGGACCAGCTTGGCTGCAGACGGTACTGCTGCCGGCGAATGGTCATG ACCCACGTTGATCTGATCGAGAAACTTCTCCGTTACAATTCCGCCGAGAAAGATCGCTCCAAGGCTCAGGTATAG |
| Transcript | >Pro_DTO377G3_2|g7305.t1 ATGATTATTCCTGTCCGTTGTTTCTCCTGTGGCAAGGTTGTCGGTGACCTCTGGGAGCGTTACCTGCAGCTCTTG GACGACGGTGTTCCAGATGGCGATGCTATGGACCAGCTTGGCTGCAGACGGTACTGCTGCCGGCGAATGGTCATG ACCCACGTTGATCTGATCGAGAAACTTCTCCGTTACAATTCCGCCGAGAAAGATCGCTCCAAGGCTCAGGTATAG |
| Gene | >Pro_DTO377G3_2|g7305.t1 ATGATTATTCCTGTCCGTTGTTTCTCCTGTGGCAAGGTGAGCAGCTGTTTTTTGAGTGCGTGATGTATGATCATT TGCTAAACTCCTGATTGTAGGTTGTCGGTGACCTCTGGGAGCGTTACCTGCAGCTCTTGGACGACGGTGTTCCAG ATGGGTATGGCAGCCTCCAGTCTATCACACCTGTCCCTGGCTAATTAACTCTTTTACAGCGATGCTATGGACCAG CTTGGCTGCAGACGGTACTGCTGCCGGCGAATGGTCATGACCCACGTTGATCTGATCGAGAAACTTCTCCGGTAC GTCTCTTATTTCGAGATTGAGTGATTGTTGCTCATTTTGTACAGTTACAATTCCGCCGAGAAAGATCGCTCCAAG GCTCAGGTATAG |