Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7305.t1
Gene name
Locationscaffold_22:187668..188055
Strand+
Gene length (bp)387
Transcript length (bp)225
Coding sequence length (bp)225
Protein length (aa) 75

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit 2.8E-29 2 59

GO

GO Term Description Terminal node
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0006351 transcription, DNA-templated Yes
GO:0003677 DNA binding Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005488 binding No
GO:0008152 metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0043170 macromolecule metabolic process No
GO:0016740 transferase activity No
GO:0003676 nucleic acid binding No
GO:0071704 organic substance metabolic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0032774 RNA biosynthetic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016070 RNA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0044238 primary metabolic process No
GO:0034062 5'-3' RNA polymerase activity No
GO:1901576 organic substance biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:0097747 RNA polymerase activity No
GO:0097659 nucleic acid-templated transcription No
GO:0140098 catalytic activity, acting on RNA No
GO:0018130 heterocycle biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0044249 cellular biosynthetic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 367.50 163.86 571.13
5d_25C Five days - 25 degrees Celsius 223.62 86.99 360.25
7d_25C Seven days - 25 degrees Celsius 212.95 80.60 345.31
10d_25C Ten days - 25 degrees Celsius 157.48 54.91 260.05
7d_15C Seven days - 15 degrees Celsius 252.20 99.37 405.02
7d_30C Seven days - 30 degrees Celsius 259.64 106.18 413.11

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.130632 no
3d_25C 7d_25C 0.089066 no
3d_25C 7d_15C 0.287707 no
3d_25C 7d_30C 0.321716 no
3d_25C 10d_25C 0.007437 yes
5d_25C 7d_25C 0.926353 no
5d_25C 7d_15C 0.796143 no
5d_25C 7d_30C 0.732058 no
5d_25C 10d_25C 0.354112 no
7d_25C 7d_15C 0.701493 no
7d_25C 7d_30C 0.631404 no
7d_25C 10d_25C 0.439798 no
7d_15C 7d_30C 0.957220 no
7d_15C 10d_25C 0.190552 no
7d_30C 10d_25C 0.139728 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7305.t1
MIIPVRCFSCGKVVGDLWERYLQLLDDGVPDGDAMDQLGCRRYCCRRMVMTHVDLIEKLLRYNSAEKDRSKAQV*
Coding >Pro_DTO377G3_2|g7305.t1
ATGATTATTCCTGTCCGTTGTTTCTCCTGTGGCAAGGTTGTCGGTGACCTCTGGGAGCGTTACCTGCAGCTCTTG
GACGACGGTGTTCCAGATGGCGATGCTATGGACCAGCTTGGCTGCAGACGGTACTGCTGCCGGCGAATGGTCATG
ACCCACGTTGATCTGATCGAGAAACTTCTCCGTTACAATTCCGCCGAGAAAGATCGCTCCAAGGCTCAGGTATAG
Transcript >Pro_DTO377G3_2|g7305.t1
ATGATTATTCCTGTCCGTTGTTTCTCCTGTGGCAAGGTTGTCGGTGACCTCTGGGAGCGTTACCTGCAGCTCTTG
GACGACGGTGTTCCAGATGGCGATGCTATGGACCAGCTTGGCTGCAGACGGTACTGCTGCCGGCGAATGGTCATG
ACCCACGTTGATCTGATCGAGAAACTTCTCCGTTACAATTCCGCCGAGAAAGATCGCTCCAAGGCTCAGGTATAG
Gene >Pro_DTO377G3_2|g7305.t1
ATGATTATTCCTGTCCGTTGTTTCTCCTGTGGCAAGGTGAGCAGCTGTTTTTTGAGTGCGTGATGTATGATCATT
TGCTAAACTCCTGATTGTAGGTTGTCGGTGACCTCTGGGAGCGTTACCTGCAGCTCTTGGACGACGGTGTTCCAG
ATGGGTATGGCAGCCTCCAGTCTATCACACCTGTCCCTGGCTAATTAACTCTTTTACAGCGATGCTATGGACCAG
CTTGGCTGCAGACGGTACTGCTGCCGGCGAATGGTCATGACCCACGTTGATCTGATCGAGAAACTTCTCCGGTAC
GTCTCTTATTTCGAGATTGAGTGATTGTTGCTCATTTTGTACAGTTACAATTCCGCCGAGAAAGATCGCTCCAAG
GCTCAGGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail