Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7297.t1
Gene name
Locationscaffold_22:169597..170491
Strand-
Gene length (bp)894
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 152 174 22
2 274 296 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7297.t1
MKFTWATTLLLLSTRALSLTIPQTESTDLIERDVDSLDSTQDSSDIITLEKRRGGGGGGRGGSSSGSSSGSSSGS
SSGGSSGGRTGSSGSSGSSGSSGSSGSSGSSGSSRGGSTSNAGGTTSAGSGTRATYGGGNYYAGGARTPYTSGSR
SAGGIAPYVLGGAALGFFPGLWLYSAYAYPYSQHYNYYNNNAHKNESLPVVCVCEQYSECGCDNNNNSTYYESLF
NGTVPKNSSLVRVVDVNGTQTIYINGTLPNGTTAADGSSTSTSSASGPVAMVLHASGYWVTVAVVVAAVWGF*
Coding >Pro_DTO377G3_2|g7297.t1
ATGAAGTTCACTTGGGCGACAACGCTCCTTCTACTTTCCACCAGGGCCTTATCCCTGACTATCCCTCAAACCGAG
TCTACCGATCTTATTGAACGAGATGTGGACTCCCTGGACTCTACCCAGGACAGCTCAGATATTATAACGCTTGAG
AAACGGCGTGGCGGTGGCGGAGGAGGCCGAGGCGGCAGCAGCAGTGGCAGCAGCAGTGGCAGCAGCAGTGGAAGC
AGCAGTGGAGGAAGCAGTGGAGGCCGCACTGGTTCTTCCGGCTCCTCGGGCTCAAGTGGCAGCAGTGGCAGCAGT
GGCAGCAGTGGAAGCAGTGGCAGCAGTCGCGGTGGTTCAACAAGCAATGCTGGTGGTACAACCAGCGCCGGCTCT
GGCACTCGAGCAACCTACGGTGGAGGCAACTACTATGCTGGCGGTGCGCGCACTCCCTACACGTCTGGCTCGCGG
TCTGCTGGAGGCATCGCCCCCTACGTGCTCGGTGGAGCCGCACTGGGTTTCTTCCCGGGTCTTTGGCTGTACAGC
GCCTACGCCTACCCCTACAGCCAGCACTACAACTACTACAATAACAATGCCCACAAGAACGAGTCGCTCCCCGTT
GTCTGTGTGTGCGAGCAGTACTCGGAGTGTGGCTGCGACAATAACAACAACAGCACATACTACGAGTCCCTCTTC
AACGGCACCGTGCCCAAGAACTCGAGTCTTGTGCGCGTGGTCGATGTGAACGGCACCCAGACCATCTACATCAAC
GGTACCTTGCCCAACGGTACCACTGCCGCTGACGGAAGCTCGACTAGTACTTCCTCGGCATCCGGGCCTGTCGCA
ATGGTCCTGCATGCTAGCGGGTACTGGGTGACAGTTGCTGTGGTAGTGGCCGCCGTATGGGGATTCTAA
Transcript >Pro_DTO377G3_2|g7297.t1
ATGAAGTTCACTTGGGCGACAACGCTCCTTCTACTTTCCACCAGGGCCTTATCCCTGACTATCCCTCAAACCGAG
TCTACCGATCTTATTGAACGAGATGTGGACTCCCTGGACTCTACCCAGGACAGCTCAGATATTATAACGCTTGAG
AAACGGCGTGGCGGTGGCGGAGGAGGCCGAGGCGGCAGCAGCAGTGGCAGCAGCAGTGGCAGCAGCAGTGGAAGC
AGCAGTGGAGGAAGCAGTGGAGGCCGCACTGGTTCTTCCGGCTCCTCGGGCTCAAGTGGCAGCAGTGGCAGCAGT
GGCAGCAGTGGAAGCAGTGGCAGCAGTCGCGGTGGTTCAACAAGCAATGCTGGTGGTACAACCAGCGCCGGCTCT
GGCACTCGAGCAACCTACGGTGGAGGCAACTACTATGCTGGCGGTGCGCGCACTCCCTACACGTCTGGCTCGCGG
TCTGCTGGAGGCATCGCCCCCTACGTGCTCGGTGGAGCCGCACTGGGTTTCTTCCCGGGTCTTTGGCTGTACAGC
GCCTACGCCTACCCCTACAGCCAGCACTACAACTACTACAATAACAATGCCCACAAGAACGAGTCGCTCCCCGTT
GTCTGTGTGTGCGAGCAGTACTCGGAGTGTGGCTGCGACAATAACAACAACAGCACATACTACGAGTCCCTCTTC
AACGGCACCGTGCCCAAGAACTCGAGTCTTGTGCGCGTGGTCGATGTGAACGGCACCCAGACCATCTACATCAAC
GGTACCTTGCCCAACGGTACCACTGCCGCTGACGGAAGCTCGACTAGTACTTCCTCGGCATCCGGGCCTGTCGCA
ATGGTCCTGCATGCTAGCGGGTACTGGGTGACAGTTGCTGTGGTAGTGGCCGCCGTATGGGGATTCTAA
Gene >Pro_DTO377G3_2|g7297.t1
ATGAAGTTCACTTGGGCGACAACGCTCCTTCTACTTTCCACCAGGGCCTTATCCCTGACTATCCCTCAAACCGAG
TCTACCGATCTTATTGAACGAGATGTGGACTCCCTGGACTCTACCCAGGACAGCTCAGATATTATAACGCTTGAG
AAACGGCGTGGCGGTGGCGGAGGAGGCCGAGGCGGCAGCAGCAGTGGCAGCAGCAGTGGCAGCAGCAGTGGAAGC
AGCAGTGGAGGAAGCAGTGGAGGCCGCACTGGTTCTTCCGGCTCCTCGGGCTCAAGTGGCAGCAGTGGCAGCAGT
GGCAGCAGTGGAAGCAGTGGCAGCAGTCGCGGTGGTTCAACAAGCAATGCTGGTGGTACAACCAGCGCCGGCTCT
GGCACTCGAGCAACCTACGGTGGAGGCAACTACTATGCTGGCGGTGCGCGCACTCCCTACACGTCTGGCTCGCGG
TCTGCTGGAGGCATCGCCCCCTACGTGCTCGGTGGAGCCGCACTGGGTTTCTTCCCGGGTCTTTGGCTGTACAGC
GCCTACGCCTACCCCTACAGCCAGCACTACAACTACTACAATAACAATGCCCACAAGAACGAGTCGCTCCCCGTT
GTCTGTGTGTGCGAGCAGTACTCGGAGTGTGGCTGCGACAATAACAACAACAGCACATACTACGAGTCCCTCTTC
AACGGCACCGTGCCCAAGAACTCGAGTCTTGTGCGCGTGGTCGATGTGAACGGCACCCAGACCATCTACATCAAC
GGTACCTTGCCCAACGGTACCACTGCCGCTGACGGAAGCTCGACTAGTACTTCCTCGGCATCCGGGCCTGTCGCA
ATGGTCCTGCATGCTAGCGGGTACTGGGTGACAGTTGCTGTGGTAGTGGCCGCCGTATGGGGATTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail