Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7296.t1
Gene name
Locationscaffold_22:168432..168885
Strand-
Gene length (bp)453
Transcript length (bp)453
Coding sequence length (bp)453
Protein length (aa) 151

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 96.47 47.13 145.81
5d_25C Five days - 25 degrees Celsius 59.25 23.26 95.24
7d_25C Seven days - 25 degrees Celsius 49.32 18.42 80.22
10d_25C Ten days - 25 degrees Celsius 29.37 7.87 50.87
7d_15C Seven days - 15 degrees Celsius 53.54 14.78 92.29
7d_30C Seven days - 30 degrees Celsius 69.77 27.83 111.70

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.105018 no
3d_25C 7d_25C 0.038966 yes
3d_25C 7d_15C 0.098297 no
3d_25C 7d_30C 0.331648 no
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.674232 no
5d_25C 7d_15C 0.842706 no
5d_25C 7d_30C 0.693798 no
5d_25C 10d_25C 0.053684 no
7d_25C 7d_15C 0.885880 no
7d_25C 7d_30C 0.354376 no
7d_25C 10d_25C 0.191260 no
7d_15C 7d_30C 0.531819 no
7d_15C 10d_25C 0.139728 no
7d_30C 10d_25C 0.013513 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7296.t1
MQFTKALLFLSALAPVAFAAESATADCITKTITLVPSGYTPPPSSTPTPTPTSTSSSVSIETPTETPIETSTEAP
SSTWTPVITSIPTLSVIPSMSHIASSTPLIKATSSSPASESASATPSPLTAGAASIHLPGFIAAGAGAIAGLLLI
*
Coding >Pro_DTO377G3_2|g7296.t1
ATGCAGTTCACCAAGGCTCTCCTCTTCCTCTCGGCCCTCGCGCCCGTCGCGTTCGCCGCTGAATCTGCCACAGCC
GACTGCATCACCAAGACCATCACTCTGGTGCCCTCTGGCTACACTCCTCCCCCGTCGTCTACCCCGACCCCCACC
CCGACCTCAACTTCGAGCTCGGTTTCGATTGAAACCCCGACTGAAACCCCCATTGAGACCTCGACTGAAGCTCCC
TCGTCGACCTGGACGCCTGTCATCACTAGCATTCCCACCCTCAGCGTCATCCCTTCCATGAGCCACATTGCCAGC
TCCACCCCCCTGATCAAGGCTACTAGCAGCTCCCCCGCCAGTGAGAGTGCCTCGGCTACTCCTTCACCTCTTACT
GCTGGTGCTGCCTCCATCCACCTCCCTGGTTTCATTGCTGCTGGTGCAGGCGCCATTGCTGGTCTTCTCTTGATC
TAA
Transcript >Pro_DTO377G3_2|g7296.t1
ATGCAGTTCACCAAGGCTCTCCTCTTCCTCTCGGCCCTCGCGCCCGTCGCGTTCGCCGCTGAATCTGCCACAGCC
GACTGCATCACCAAGACCATCACTCTGGTGCCCTCTGGCTACACTCCTCCCCCGTCGTCTACCCCGACCCCCACC
CCGACCTCAACTTCGAGCTCGGTTTCGATTGAAACCCCGACTGAAACCCCCATTGAGACCTCGACTGAAGCTCCC
TCGTCGACCTGGACGCCTGTCATCACTAGCATTCCCACCCTCAGCGTCATCCCTTCCATGAGCCACATTGCCAGC
TCCACCCCCCTGATCAAGGCTACTAGCAGCTCCCCCGCCAGTGAGAGTGCCTCGGCTACTCCTTCACCTCTTACT
GCTGGTGCTGCCTCCATCCACCTCCCTGGTTTCATTGCTGCTGGTGCAGGCGCCATTGCTGGTCTTCTCTTGATC
TAA
Gene >Pro_DTO377G3_2|g7296.t1
ATGCAGTTCACCAAGGCTCTCCTCTTCCTCTCGGCCCTCGCGCCCGTCGCGTTCGCCGCTGAATCTGCCACAGCC
GACTGCATCACCAAGACCATCACTCTGGTGCCCTCTGGCTACACTCCTCCCCCGTCGTCTACCCCGACCCCCACC
CCGACCTCAACTTCGAGCTCGGTTTCGATTGAAACCCCGACTGAAACCCCCATTGAGACCTCGACTGAAGCTCCC
TCGTCGACCTGGACGCCTGTCATCACTAGCATTCCCACCCTCAGCGTCATCCCTTCCATGAGCCACATTGCCAGC
TCCACCCCCCTGATCAAGGCTACTAGCAGCTCCCCCGCCAGTGAGAGTGCCTCGGCTACTCCTTCACCTCTTACT
GCTGGTGCTGCCTCCATCCACCTCCCTGGTTTCATTGCTGCTGGTGCAGGCGCCATTGCTGGTCTTCTCTTGATC
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail