Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7294.t1
Gene name
Locationscaffold_22:161806..165739
Strand+
Gene length (bp)3933
Transcript length (bp)3741
Coding sequence length (bp)3741
Protein length (aa) 1247

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01237 Oxysterol_BP Oxysterol-binding protein 1.3E-133 870 1232
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.6E-07 133 203
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.4E-06 146 218
PF13857 Ank_5 Ankyrin repeats (many copies) 5.0E-08 167 218
PF00023 Ank Ankyrin repeat 7.9E-03 176 203
PF00169 PH PH domain 1.3E-10 378 470
PF13637 Ank_4 Ankyrin repeats (many copies) 9.4E-06 143 197

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7294.t1
MPLSRRHKHKRSRSAIALSLLHRDKSKGEDKDPDNNVDTNSPTSASPSPGPLKHTHSSSSRHSRRKPGQDTSSPP
AIQESAEDMDTVEDLPSLNQIETGSMSLEQSVRTFRLFEILRSGDTTAISKAIKDTIDPQGVSYLNGTTVLHLAL
QCAEPQVVEYVLSNAEDIDINSRDRDGNTPLHIAAQLGRGPLVRDLLNRPSINDSIVNYRGQTPLDLARTPEIFQ
QLQLARSLFIDSKNQEIQALIKNADYKGLEALLEEPRVEGIMDVNSYDLVTDPTTAQSGGTLLHEGARSKDAQLI
EILLTHGADPFRRDRKGKLPQDVTKDDKIRALLKRSPAAAIAQRGIQERAILGNSNAQGLAGRVSIGDAPLAGKD
AREMRGYLKKWTNYTTGYKLRWFVLEDGVLSYYKHQDDAGSACRGAINMKIARLSMDAQDKTRFEIHGKSSVKYH
LKANHVVEAKRWFWSLNNAIQWAKDEAKEEERQRSKNAEVLRQAKIDHTEGRPTDTPSESGLSHKPSTKNLAPPS
LGGGSSSGTRLSTYASRTTLDTPVGDEDSSIYGGSYDHVPAPNDMNRVVSHAASTPEGEGDDEEYIDYGSSHDND
ISAADKDALNITAQSAKLQLDLLANVAASLQAEKSKNPQMTIADPALEEALGAYEAAVSSLKGLVQNLLKISRDR
DSYWQSRLSREESIRQMWEESMARVAREHEELQSKMGESEEKRKRTKRALKEALESATGSSRSIVGGTSRLPTER
QSLEANQIEAGATETDKAEQPTQEPSEVPELSRKPSNYSELSSLCDSESDGEEFFDAIDAGEIEVEDVSNTKKIN
MEPPKDESAELRAVKSTLIAPSFKGYEDPIRERLKMDADDRPKISLWSILKSMIGKDMTKMTLPVSFNEPTSLLQ
RVAEDLEYTDLLDIAAGRADSMERLVYVASYAASEYASTIGRVAKPFNPLLGETFEYVRPDKGYRFFVEQVSHHP
PIGAAWAESPKWDYWGESSLKSKFYGKSFDINLLGTWFLKLRPSSGGEELYTWKKVTSSVIGIITGNPTVDNYGL
MEIKNWTTGEVCYLDFKPRGWKASSAYQVTGKVVDSEGSPRWSIGGRWNDKIYARHTPGFEAPVSGQDPESAKTF
LVWQAHERPTGLPFNLTPFVITLNALPDALKEWLPPTDTRRRPDQRAMEDGEYDLAADEKHRVEEKQRARRRERD
TNGEVYEPQWFIRDKCPVTGEEFWAHNGKYWESRDAHDWSRSEDIF*
Coding >Pro_DTO377G3_2|g7294.t1
ATGCCACTGTCTCGCAGGCACAAACACAAACGCTCTCGAAGCGCAATAGCACTTTCCCTCCTCCACCGCGACAAG
TCCAAAGGCGAAGATAAAGATCCCGATAACAACGTAGACACCAACTCGCCCACCTCCGCCTCACCAAGCCCGGGC
CCATTGAAACACACCCACAGCAGCAGCAGTCGCCATAGCCGTCGCAAACCAGGCCAGGACACAAGTTCGCCACCC
GCCATTCAAGAATCCGCCGAGGATATGGACACAGTCGAAGACCTGCCTTCCTTGAATCAAATAGAGACTGGCAGC
ATGTCGCTCGAACAGTCCGTTCGCACCTTTCGTCTCTTCGAGATCTTGCGCAGCGGCGATACCACCGCTATCTCC
AAGGCCATCAAGGATACCATCGACCCGCAGGGTGTGAGTTATCTCAACGGCACGACCGTCCTCCATTTGGCTTTG
CAATGCGCCGAGCCCCAGGTCGTGGAATATGTGCTGTCCAATGCGGAGGATATCGATATCAACTCGCGAGATCGG
GATGGAAACACCCCACTTCACATTGCTGCCCAGCTGGGCCGGGGCCCGCTTGTTCGCGATTTGCTGAATCGTCCA
TCGATCAATGATTCCATTGTCAACTATCGCGGTCAGACGCCTCTCGATCTGGCCCGTACCCCGGAAATTTTCCAG
CAGCTTCAGCTTGCGCGGTCTCTCTTCATCGATAGCAAGAACCAGGAAATTCAGGCTTTGATTAAAAACGCTGAT
TATAAGGGCTTGGAGGCTTTGCTGGAGGAACCTCGAGTGGAGGGTATTATGGATGTGAACAGCTACGACCTAGTT
ACCGACCCGACGACAGCCCAATCCGGCGGCACGCTTCTGCATGAGGGTGCTAGAAGTAAAGATGCGCAGCTCATT
GAAATCCTTCTGACGCATGGCGCCGATCCTTTCCGCCGTGACAGGAAGGGGAAGCTACCGCAGGATGTTACCAAA
GATGATAAAATCCGTGCTCTCTTGAAGAGATCACCCGCTGCTGCTATTGCCCAGCGCGGTATTCAGGAAAGGGCT
ATTCTTGGAAATAGTAATGCCCAAGGCCTTGCCGGGCGCGTTTCGATTGGTGATGCCCCGCTTGCCGGCAAGGAT
GCTCGCGAAATGAGAGGCTATCTCAAGAAATGGACCAATTACACAACGGGTTATAAGTTGCGCTGGTTCGTTCTA
GAGGATGGAGTTTTGAGTTATTATAAACATCAGGACGATGCCGGCTCTGCCTGTCGCGGTGCCATTAACATGAAG
ATTGCTAGACTTAGCATGGATGCGCAGGATAAGACGCGTTTTGAAATCCACGGCAAGTCGTCGGTCAAATACCAC
CTCAAGGCCAACCATGTTGTGGAGGCAAAACGCTGGTTCTGGTCTCTCAACAATGCCATTCAGTGGGCCAAGGAC
GAAGCGAAGGAGGAGGAGCGTCAGCGGTCCAAGAACGCAGAAGTGCTTCGCCAGGCTAAGATCGATCACACAGAA
GGACGTCCTACAGATACCCCATCAGAGTCTGGTCTTTCTCACAAGCCTAGCACAAAGAATCTCGCTCCTCCGTCT
TTGGGCGGTGGTAGCAGCAGTGGCACAAGGCTCAGTACATATGCATCTCGCACCACCCTAGATACTCCAGTTGGA
GACGAGGACAGCTCCATTTATGGCGGTTCTTATGACCACGTCCCTGCTCCAAATGACATGAACAGAGTAGTCAGT
CATGCCGCATCTACGCCGGAGGGGGAGGGCGATGATGAAGAATATATCGACTATGGTTCAAGTCACGATAACGAC
ATCTCAGCCGCTGATAAAGATGCCCTCAATATCACCGCACAATCTGCGAAGCTTCAGTTGGATCTTCTTGCAAAT
GTGGCAGCCTCGCTACAAGCCGAGAAATCCAAGAATCCGCAAATGACCATCGCGGATCCAGCCCTCGAAGAGGCA
CTCGGTGCCTACGAAGCCGCAGTCAGCAGCCTCAAGGGTCTAGTGCAGAACCTGCTGAAGATATCACGGGACCGA
GACTCTTATTGGCAGTCTCGTCTTAGTAGAGAGGAGTCCATTCGTCAAATGTGGGAAGAAAGCATGGCCCGCGTG
GCCCGCGAGCACGAGGAGCTGCAATCTAAGATGGGCGAGTCCGAGGAGAAGCGGAAGCGGACTAAGCGGGCTCTG
AAGGAAGCCCTGGAGAGCGCAACAGGCAGTAGCCGTTCTATCGTCGGTGGGACATCCCGTTTGCCAACAGAGAGA
CAGAGTCTTGAGGCCAACCAAATTGAAGCTGGGGCTACCGAGACAGATAAAGCAGAGCAGCCCACACAGGAACCA
TCCGAAGTACCCGAACTGTCTCGCAAACCATCAAACTACTCCGAGCTCAGCAGTCTCTGCGATTCAGAATCGGAC
GGAGAAGAATTCTTTGATGCTATTGATGCCGGTGAAATCGAGGTAGAGGATGTCAGCAATACCAAGAAAATCAAT
ATGGAACCACCGAAAGACGAAAGTGCTGAGCTTCGGGCTGTGAAGAGTACCCTCATCGCACCATCCTTTAAGGGT
TACGAGGATCCCATCAGAGAGCGACTTAAGATGGATGCTGATGATCGGCCAAAGATTTCTTTATGGAGTATCCTG
AAATCTATGATTGGAAAGGACATGACGAAGATGACGCTCCCGGTGTCCTTCAACGAACCAACTTCACTACTTCAG
CGAGTGGCTGAGGATCTTGAATATACCGACCTCCTTGACATCGCTGCTGGTCGGGCCGATTCAATGGAACGCCTG
GTCTACGTCGCCTCCTACGCCGCAAGTGAGTATGCTTCGACCATCGGCCGTGTCGCAAAGCCCTTCAACCCCCTT
CTGGGTGAAACCTTCGAGTACGTGCGTCCGGACAAGGGCTATCGGTTCTTTGTGGAGCAAGTTAGCCACCACCCA
CCGATTGGAGCTGCGTGGGCCGAATCGCCCAAATGGGACTACTGGGGTGAATCCTCCCTCAAGTCCAAGTTCTAT
GGCAAATCCTTCGACATCAACCTGCTGGGCACATGGTTCCTGAAGCTGCGACCTTCCTCTGGTGGAGAAGAACTT
TACACCTGGAAGAAGGTGACCTCGTCGGTCATTGGCATCATTACTGGTAACCCCACGGTGGACAACTACGGTTTG
ATGGAAATCAAGAATTGGACCACCGGCGAAGTCTGCTACCTCGACTTCAAGCCCCGTGGCTGGAAGGCCTCATCG
GCCTACCAGGTGACAGGAAAGGTCGTCGACAGCGAAGGCTCTCCCAGGTGGAGCATCGGTGGCCGCTGGAACGAT
AAGATCTACGCCCGCCATACCCCCGGCTTCGAGGCACCTGTCTCCGGCCAGGATCCCGAGTCCGCCAAGACATTC
TTGGTCTGGCAAGCTCATGAACGTCCTACTGGTCTACCTTTCAACCTGACTCCATTCGTCATCACACTCAATGCT
CTCCCGGACGCCTTGAAGGAGTGGCTACCTCCTACCGATACCAGAAGGCGACCGGATCAGCGTGCTATGGAAGAT
GGTGAATATGATTTGGCTGCTGATGAGAAGCACCGCGTTGAAGAGAAGCAGCGTGCCAGGCGCAGAGAACGCGAT
ACCAACGGCGAGGTCTACGAGCCGCAATGGTTCATCCGTGACAAGTGTCCTGTTACGGGAGAGGAGTTCTGGGCT
CACAATGGAAAATACTGGGAGTCCAGAGATGCGCATGATTGGAGTCGATCCGAGGATATTTTCTGA
Transcript >Pro_DTO377G3_2|g7294.t1
ATGCCACTGTCTCGCAGGCACAAACACAAACGCTCTCGAAGCGCAATAGCACTTTCCCTCCTCCACCGCGACAAG
TCCAAAGGCGAAGATAAAGATCCCGATAACAACGTAGACACCAACTCGCCCACCTCCGCCTCACCAAGCCCGGGC
CCATTGAAACACACCCACAGCAGCAGCAGTCGCCATAGCCGTCGCAAACCAGGCCAGGACACAAGTTCGCCACCC
GCCATTCAAGAATCCGCCGAGGATATGGACACAGTCGAAGACCTGCCTTCCTTGAATCAAATAGAGACTGGCAGC
ATGTCGCTCGAACAGTCCGTTCGCACCTTTCGTCTCTTCGAGATCTTGCGCAGCGGCGATACCACCGCTATCTCC
AAGGCCATCAAGGATACCATCGACCCGCAGGGTGTGAGTTATCTCAACGGCACGACCGTCCTCCATTTGGCTTTG
CAATGCGCCGAGCCCCAGGTCGTGGAATATGTGCTGTCCAATGCGGAGGATATCGATATCAACTCGCGAGATCGG
GATGGAAACACCCCACTTCACATTGCTGCCCAGCTGGGCCGGGGCCCGCTTGTTCGCGATTTGCTGAATCGTCCA
TCGATCAATGATTCCATTGTCAACTATCGCGGTCAGACGCCTCTCGATCTGGCCCGTACCCCGGAAATTTTCCAG
CAGCTTCAGCTTGCGCGGTCTCTCTTCATCGATAGCAAGAACCAGGAAATTCAGGCTTTGATTAAAAACGCTGAT
TATAAGGGCTTGGAGGCTTTGCTGGAGGAACCTCGAGTGGAGGGTATTATGGATGTGAACAGCTACGACCTAGTT
ACCGACCCGACGACAGCCCAATCCGGCGGCACGCTTCTGCATGAGGGTGCTAGAAGTAAAGATGCGCAGCTCATT
GAAATCCTTCTGACGCATGGCGCCGATCCTTTCCGCCGTGACAGGAAGGGGAAGCTACCGCAGGATGTTACCAAA
GATGATAAAATCCGTGCTCTCTTGAAGAGATCACCCGCTGCTGCTATTGCCCAGCGCGGTATTCAGGAAAGGGCT
ATTCTTGGAAATAGTAATGCCCAAGGCCTTGCCGGGCGCGTTTCGATTGGTGATGCCCCGCTTGCCGGCAAGGAT
GCTCGCGAAATGAGAGGCTATCTCAAGAAATGGACCAATTACACAACGGGTTATAAGTTGCGCTGGTTCGTTCTA
GAGGATGGAGTTTTGAGTTATTATAAACATCAGGACGATGCCGGCTCTGCCTGTCGCGGTGCCATTAACATGAAG
ATTGCTAGACTTAGCATGGATGCGCAGGATAAGACGCGTTTTGAAATCCACGGCAAGTCGTCGGTCAAATACCAC
CTCAAGGCCAACCATGTTGTGGAGGCAAAACGCTGGTTCTGGTCTCTCAACAATGCCATTCAGTGGGCCAAGGAC
GAAGCGAAGGAGGAGGAGCGTCAGCGGTCCAAGAACGCAGAAGTGCTTCGCCAGGCTAAGATCGATCACACAGAA
GGACGTCCTACAGATACCCCATCAGAGTCTGGTCTTTCTCACAAGCCTAGCACAAAGAATCTCGCTCCTCCGTCT
TTGGGCGGTGGTAGCAGCAGTGGCACAAGGCTCAGTACATATGCATCTCGCACCACCCTAGATACTCCAGTTGGA
GACGAGGACAGCTCCATTTATGGCGGTTCTTATGACCACGTCCCTGCTCCAAATGACATGAACAGAGTAGTCAGT
CATGCCGCATCTACGCCGGAGGGGGAGGGCGATGATGAAGAATATATCGACTATGGTTCAAGTCACGATAACGAC
ATCTCAGCCGCTGATAAAGATGCCCTCAATATCACCGCACAATCTGCGAAGCTTCAGTTGGATCTTCTTGCAAAT
GTGGCAGCCTCGCTACAAGCCGAGAAATCCAAGAATCCGCAAATGACCATCGCGGATCCAGCCCTCGAAGAGGCA
CTCGGTGCCTACGAAGCCGCAGTCAGCAGCCTCAAGGGTCTAGTGCAGAACCTGCTGAAGATATCACGGGACCGA
GACTCTTATTGGCAGTCTCGTCTTAGTAGAGAGGAGTCCATTCGTCAAATGTGGGAAGAAAGCATGGCCCGCGTG
GCCCGCGAGCACGAGGAGCTGCAATCTAAGATGGGCGAGTCCGAGGAGAAGCGGAAGCGGACTAAGCGGGCTCTG
AAGGAAGCCCTGGAGAGCGCAACAGGCAGTAGCCGTTCTATCGTCGGTGGGACATCCCGTTTGCCAACAGAGAGA
CAGAGTCTTGAGGCCAACCAAATTGAAGCTGGGGCTACCGAGACAGATAAAGCAGAGCAGCCCACACAGGAACCA
TCCGAAGTACCCGAACTGTCTCGCAAACCATCAAACTACTCCGAGCTCAGCAGTCTCTGCGATTCAGAATCGGAC
GGAGAAGAATTCTTTGATGCTATTGATGCCGGTGAAATCGAGGTAGAGGATGTCAGCAATACCAAGAAAATCAAT
ATGGAACCACCGAAAGACGAAAGTGCTGAGCTTCGGGCTGTGAAGAGTACCCTCATCGCACCATCCTTTAAGGGT
TACGAGGATCCCATCAGAGAGCGACTTAAGATGGATGCTGATGATCGGCCAAAGATTTCTTTATGGAGTATCCTG
AAATCTATGATTGGAAAGGACATGACGAAGATGACGCTCCCGGTGTCCTTCAACGAACCAACTTCACTACTTCAG
CGAGTGGCTGAGGATCTTGAATATACCGACCTCCTTGACATCGCTGCTGGTCGGGCCGATTCAATGGAACGCCTG
GTCTACGTCGCCTCCTACGCCGCAAGTGAGTATGCTTCGACCATCGGCCGTGTCGCAAAGCCCTTCAACCCCCTT
CTGGGTGAAACCTTCGAGTACGTGCGTCCGGACAAGGGCTATCGGTTCTTTGTGGAGCAAGTTAGCCACCACCCA
CCGATTGGAGCTGCGTGGGCCGAATCGCCCAAATGGGACTACTGGGGTGAATCCTCCCTCAAGTCCAAGTTCTAT
GGCAAATCCTTCGACATCAACCTGCTGGGCACATGGTTCCTGAAGCTGCGACCTTCCTCTGGTGGAGAAGAACTT
TACACCTGGAAGAAGGTGACCTCGTCGGTCATTGGCATCATTACTGGTAACCCCACGGTGGACAACTACGGTTTG
ATGGAAATCAAGAATTGGACCACCGGCGAAGTCTGCTACCTCGACTTCAAGCCCCGTGGCTGGAAGGCCTCATCG
GCCTACCAGGTGACAGGAAAGGTCGTCGACAGCGAAGGCTCTCCCAGGTGGAGCATCGGTGGCCGCTGGAACGAT
AAGATCTACGCCCGCCATACCCCCGGCTTCGAGGCACCTGTCTCCGGCCAGGATCCCGAGTCCGCCAAGACATTC
TTGGTCTGGCAAGCTCATGAACGTCCTACTGGTCTACCTTTCAACCTGACTCCATTCGTCATCACACTCAATGCT
CTCCCGGACGCCTTGAAGGAGTGGCTACCTCCTACCGATACCAGAAGGCGACCGGATCAGCGTGCTATGGAAGAT
GGTGAATATGATTTGGCTGCTGATGAGAAGCACCGCGTTGAAGAGAAGCAGCGTGCCAGGCGCAGAGAACGCGAT
ACCAACGGCGAGGTCTACGAGCCGCAATGGTTCATCCGTGACAAGTGTCCTGTTACGGGAGAGGAGTTCTGGGCT
CACAATGGAAAATACTGGGAGTCCAGAGATGCGCATGATTGGAGTCGATCCGAGGATATTTTCTGA
Gene >Pro_DTO377G3_2|g7294.t1
ATGCCACTGTCTCGCAGGCACAAACACAAACGCTCTCGAAGCGCAATAGCACTTTCCCTCCTCCACCGCGACAAG
TCCAAAGGCGAAGATAAAGATCCCGATAACAACGTAGACACCAACTCGCCCACCTCCGCCTCACCAAGCCCGGGC
CCATTGAAACACACCCACAGCAGCAGCAGTCGCCATAGCCGTCGCAAACCAGGCCAGGACACAAGTTCGCCACCC
GCCATTCAAGAATCCGCCGAGGATATGGACACAGTCGAAGACCTGCCTTCCTTGAATCAAATAGAGACTGGCAGC
ATGTCGCTCGAACAGTCCGTTCGCACCTTTCGTCTCTTCGAGATCTTGCGCAGCGGCGATACCACCGCTATCTCC
AAGGCCATCAAGGATACCATCGACCCGCAGGGTGTGAGTTATCTCAACGGCACGACCGTCCTCCATTTGGCTTTG
CAATGCGCCGAGCCCCAGGTCGTGGAATATGTGCTGTCCAATGCGGAGGATATCGATATCAACTCGCGAGATCGG
GATGGAAACACCCCACTTCACATTGCTGCCCAGCTGGGCCGGGGCCCGCTTGTTCGCGATTTGCTGAATCGTCCA
TCGATCAATGATTCCATTGTCAACTATCGCGGTCAGACGCCTCTCGATCTGGCCCGTACCCCGGAAATTTTCCAG
CAGCTTCAGCTTGCGCGGTCTCTCTTCATCGATAGCAAGAACCAGGAAATTCAGGCTTTGATTAAAAACGCTGAT
TATAAGGGCTTGGAGGCTTTGCTGGAGGAACCTCGAGTGGAGGGTATTATGGATGTGAACAGCTACGACCTAGTT
ACCGACCCGACGACAGCCCAATCCGGCGGCACGCTTCTGCATGAGGGTGCTAGAAGTAAAGATGCGCAGCTCATT
GAAATCCTTCTGACGCATGGCGCCGATCCTTTCCGCCGTGACAGGAAGGGGAAGCTACCGCAGGATGTTACCAAA
GATGATAAAATCCGTGCTCTCTTGAAGAGATCACCCGCTGCTGCTATTGCCCAGCGCGGTATTCAGGAAAGGGCT
ATTCTTGGAAATAGTAATGCCCAAGGCCTTGCCGGGCGCGTTTCGATTGGTGATGCCCCGCTTGCCGGCAAGGAT
GCTCGCGAAATGAGAGGCTATCTCAAGAAATGGACCAATTACACAACGGGTTATAAGTTGCGCTGGTTCGTTCTA
GAGGATGGAGTTTTGAGTTATTATAAACATCAGGGTAAGCTCACGGCTCATCTTCAGTTTCGCATCACCCCTCGT
GCCGTCGACCCCTGCTAAATTTCTCTATAGACGATGCCGGCTCTGCCTGTCGCGGTGCCATTAACATGAAGATTG
CTAGACTTAGCATGGATGCGCAGGATAAGACGCGTTTTGAAATCCACGGCAAGTCGTCGGTCAAATACCACCTCA
AGGCCAACCATGTTGTGGAGGCAAAACGCTGGTTCTGGTCTCTCAACAATGCCATTCAGTGGGCCAAGGACGAAG
CGAAGGAGGAGGAGCGTCAGCGGTCCAAGAACGCAGAAGTGCTTCGCCAGGCTAAGATCGATCACACAGAAGGAC
GTCCTACAGATACCCCATCAGAGTCTGGTCTTTCTCACAAGCCTAGCACAAAGAATCTCGCTCCTCCGTCTTTGG
GCGGTGGTAGCAGCAGTGGCACAAGGCTCAGTACATATGCATCTCGCACCACCCTAGATACTCCAGTTGGAGACG
AGGACAGCTCCATTTATGGCGGTTCTTATGACCACGTCCCTGCTCCAAATGACATGAACAGAGTAGTCAGTCATG
CCGCATCTACGCCGGAGGGGGAGGGCGATGATGAAGAATATATCGACTATGGTTCAAGTCACGATAACGACATCT
CAGCCGCTGATAAAGATGCCCTCAATATCACCGCACAATCTGCGAAGCTTCAGTTGGATCTTCTTGCAAATGTGG
CAGCCTCGCTACAAGCCGAGAAATCCAAGAATCCGCAAATGACCATCGCGGATCCAGCCCTCGAAGAGGCACTCG
GTGCCTACGAAGCCGCAGTCAGCAGCCTCAAGGGTCTAGTGCAGAACCTGCTGAAGATATCACGGGACCGAGACT
CTTATTGGCAGTCTCGTCTTAGTAGAGAGGAGTCCATTCGTCAAATGTGGGAAGAAAGCATGGCCCGCGTGGCCC
GCGAGCACGAGGAGCTGCAATCTAAGATGGGCGAGTCCGAGGAGAAGCGGAAGCGGACTAAGCGGGCTCTGAAGG
AAGCCCTGGAGAGCGCAACAGGCAGTAGCCGTTCTATCGTCGGTGGGACATCCCGTTTGCCAACAGAGAGACAGA
GTCTTGAGGCCAACCAAATTGAAGCTGGGGCTACCGAGACAGATAAAGCAGAGCAGCCCACACAGGAACCATCCG
AAGTACCCGAACTGTCTCGCAAACCATCAAACTACTCCGAGCTCAGCAGTCTCTGCGATTCAGAATCGGACGGAG
AAGAATTCTTTGATGCTATTGATGCCGGTGAAATCGAGGTAGAGGATGTCAGCAATACCAAGAAAATCAATATGG
AACCACCGAAAGACGAAAGTGCTGAGCTTCGGGCTGTGAAGAGTACCCTCATCGCACCATCCTTTAAGGGTTACG
AGGATCCCATCAGAGAGCGACTTAAGATGGATGCTGATGATCGGCCAAAGATTTCTTTATGGGTAAGCTGTGAAG
TTAGCTTCTGTTTTTTTCTTTGCCAGTGCTAACCACAATTTTAGAGTATCCTGAAATCTATGATTGGAAAGGACA
TGACGAAGATGACGCTCCCGGTGTCCTTCAACGAACCAACTTCACTACTTCAGCGAGTGGCTGAGGATCTTGAAT
ATACCGACCTCCTTGACATCGCTGCTGGTCGGGCCGATTCAATGGAACGCCTGGTCTACGTCGCCTCCTACGCCG
CAAGTGAGTATGCTTCGACCATCGGCCGTGTCGCAAAGCCCTTCAACCCCCTTCTGGGTGAAACCTTCGAGTACG
TGCGTCCGGACAAGGGCTATCGGTTCTTTGTGGAGCAAGTTAGCCACCACCCACCGATTGGAGCTGCGTGGGCCG
AATCGCCCAAATGGGACTACTGGGTAAGTGCATCCGATTTTGTAGGCGTATATCTGTTACCAGGGCTAACCCAAA
CTACGTATATAGGGTGAATCCTCCCTCAAGTCCAAGTTCTATGGCAAATCCTTCGACATCAACCTGCTGGGCACA
TGGTTCCTGAAGCTGCGACCTTCCTCTGGTGGAGAAGAACTTTACACCTGGAAGAAGGTGACCTCGTCGGTCATT
GGCATCATTACTGGTAACCCCACGGTGGACAACTACGGTTTGATGGAAATCAAGAATTGGACCACCGGCGAAGTC
TGCTACCTCGACTTCAAGCCCCGTGGCTGGAAGGCCTCATCGGCCTACCAGGTGACAGGAAAGGTCGTCGACAGC
GAAGGCTCTCCCAGGTGGAGCATCGGTGGCCGCTGGAACGATAAGATCTACGCCCGCCATACCCCCGGCTTCGAG
GCACCTGTCTCCGGCCAGGATCCCGAGTCCGCCAAGACATTCTTGGTCTGGCAAGCTCATGAACGTCCTACTGGT
CTACCTTTCAACCTGACTCCATTCGTCATCACACTCAATGCTCTCCCGGACGCCTTGAAGGAGTGGCTACCTCCT
ACCGATACCAGAAGGCGACCGGATCAGCGTGCTATGGAAGATGGTGAATATGATTTGGCTGCTGATGAGAAGCAC
CGCGTTGAAGAGAAGCAGCGTGCCAGGCGCAGAGAACGCGATACCAACGGCGAGGTCTACGAGCCGCAATGGTTC
ATCCGTGACAAGTGTCCTGTTACGGGAGAGGAGTTCTGGGCTCACAATGGAAAATACTGGGAGTCCAGAGATGCG
CATGATTGGAGTCGATCCGAGGATATTTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail