Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7293.t1
Gene name
Locationscaffold_22:158215..159370
Strand+
Gene length (bp)1155
Transcript length (bp)1071
Coding sequence length (bp)1071
Protein length (aa) 357

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07542 ATP12 ATP12 chaperone protein 1.8E-44 80 224

GO

GO Term Description Terminal node
GO:0043461 proton-transporting ATP synthase complex assembly Yes
GO:0008150 biological_process No
GO:0043933 protein-containing complex organization No
GO:0009987 cellular process No
GO:0016043 cellular component organization No
GO:0065003 protein-containing complex assembly No
GO:0070071 proton-transporting two-sector ATPase complex assembly No
GO:0071840 cellular component organization or biogenesis No
GO:0022607 cellular component assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7293.t1
MVAFARAALSSQLSAVARPVSLCRRIHSSHFRSAVAHPITAHGPPPKAPELKEKSKPKEAELPAPEGEGSRYNLT
AALRKRFWKDVHVHGKSDEYQVLLDKRPVRTPTKEVLTIPSTKPHLAHAIALEWDVMASAQEALKSHLIPMTSLA
ARATDIAREDAEGKNTTRKQILTTAMRYLDTDTLLCWEPEREMHVLERTAADGTPIESLRQIQTRIAGNVMSFLS
TKVWPGLEIIPILDANSILPLAQPKGTKDSIGTWVSGLSAYDLAGLERAIIASKSLLIAVRLVVEWSENFRHLQR
PETKRFGIEEAAEASSLEVTWQTNQWGEVEDTHDVGKEDLKRQLGSVVILVSGETR*
Coding >Pro_DTO377G3_2|g7293.t1
ATGGTGGCTTTCGCTCGCGCTGCGCTGTCTTCGCAGCTATCCGCCGTCGCCCGTCCAGTCTCGTTATGCCGACGC
ATCCACTCGTCTCACTTCAGATCAGCTGTTGCACACCCAATCACTGCTCACGGCCCTCCTCCTAAAGCCCCAGAG
CTCAAGGAAAAGTCAAAACCGAAGGAGGCGGAGCTCCCAGCCCCCGAGGGTGAAGGATCGCGATACAACCTCACC
GCTGCGTTGAGGAAGCGGTTTTGGAAAGATGTCCATGTGCATGGAAAGTCAGACGAATATCAAGTCCTGCTGGAC
AAGCGACCCGTCCGAACCCCGACGAAAGAAGTCCTGACTATTCCCTCCACAAAGCCCCACCTCGCCCACGCTATT
GCACTGGAGTGGGATGTGATGGCCTCCGCCCAGGAGGCTCTTAAAAGCCACCTCATCCCTATGACCTCCCTCGCA
GCCCGCGCCACCGATATCGCCCGTGAAGATGCCGAGGGCAAAAACACCACCAGAAAACAGATTCTCACAACCGCC
ATGCGTTACCTAGATACGGATACCCTACTCTGCTGGGAGCCCGAGCGAGAAATGCACGTGCTGGAGCGGACGGCG
GCCGATGGAACGCCCATCGAGAGTCTTCGCCAGATTCAAACGAGAATTGCCGGCAACGTCATGAGCTTTTTGTCC
ACTAAGGTCTGGCCTGGCCTTGAAATCATCCCTATCCTCGACGCCAATAGCATTCTTCCTCTCGCCCAGCCGAAG
GGTACGAAAGACAGTATCGGCACTTGGGTTTCGGGACTGTCTGCGTATGATCTGGCCGGTCTGGAGCGCGCAATC
ATTGCTTCCAAGAGTCTTCTCATTGCGGTGCGCCTGGTGGTGGAATGGAGTGAGAACTTCCGCCATCTTCAGCGA
CCTGAGACGAAGAGGTTCGGTATCGAGGAGGCGGCTGAGGCGTCGAGTCTGGAGGTGACCTGGCAGACTAACCAA
TGGGGCGAGGTAGAGGATACCCACGATGTTGGCAAGGAAGACTTGAAGCGACAGTTGGGTAGTGTTGTGATCTTG
GTTAGTGGAGAGACTCGGTAA
Transcript >Pro_DTO377G3_2|g7293.t1
ATGGTGGCTTTCGCTCGCGCTGCGCTGTCTTCGCAGCTATCCGCCGTCGCCCGTCCAGTCTCGTTATGCCGACGC
ATCCACTCGTCTCACTTCAGATCAGCTGTTGCACACCCAATCACTGCTCACGGCCCTCCTCCTAAAGCCCCAGAG
CTCAAGGAAAAGTCAAAACCGAAGGAGGCGGAGCTCCCAGCCCCCGAGGGTGAAGGATCGCGATACAACCTCACC
GCTGCGTTGAGGAAGCGGTTTTGGAAAGATGTCCATGTGCATGGAAAGTCAGACGAATATCAAGTCCTGCTGGAC
AAGCGACCCGTCCGAACCCCGACGAAAGAAGTCCTGACTATTCCCTCCACAAAGCCCCACCTCGCCCACGCTATT
GCACTGGAGTGGGATGTGATGGCCTCCGCCCAGGAGGCTCTTAAAAGCCACCTCATCCCTATGACCTCCCTCGCA
GCCCGCGCCACCGATATCGCCCGTGAAGATGCCGAGGGCAAAAACACCACCAGAAAACAGATTCTCACAACCGCC
ATGCGTTACCTAGATACGGATACCCTACTCTGCTGGGAGCCCGAGCGAGAAATGCACGTGCTGGAGCGGACGGCG
GCCGATGGAACGCCCATCGAGAGTCTTCGCCAGATTCAAACGAGAATTGCCGGCAACGTCATGAGCTTTTTGTCC
ACTAAGGTCTGGCCTGGCCTTGAAATCATCCCTATCCTCGACGCCAATAGCATTCTTCCTCTCGCCCAGCCGAAG
GGTACGAAAGACAGTATCGGCACTTGGGTTTCGGGACTGTCTGCGTATGATCTGGCCGGTCTGGAGCGCGCAATC
ATTGCTTCCAAGAGTCTTCTCATTGCGGTGCGCCTGGTGGTGGAATGGAGTGAGAACTTCCGCCATCTTCAGCGA
CCTGAGACGAAGAGGTTCGGTATCGAGGAGGCGGCTGAGGCGTCGAGTCTGGAGGTGACCTGGCAGACTAACCAA
TGGGGCGAGGTAGAGGATACCCACGATGTTGGCAAGGAAGACTTGAAGCGACAGTTGGGTAGTGTTGTGATCTTG
GTTAGTGGAGAGACTCGGTAA
Gene >Pro_DTO377G3_2|g7293.t1
ATGGTGGCTTTCGCTCGCGCTGCGCTGTCTTCGCAGCTATCCGCCGTCGCCCGTCCAGTCTCGTTATGCCGACGC
ATCCACTCGTCTCACTTCAGATCAGCTGTTGCACACCCAATCACTGCTCACGGCCCTCCTCCTAAAGCCCCAGAG
CTCAAGGAAAAGTCAAAACCGAAGGAGGCGGAGCTCCCAGCCCCCGAGGGTGAAGGATCGCGATACAACCTCACC
GCTGCGTTGAGGAAGCGGTTTTGGAAAGATGTCCATGTGCATGGAAAGTCAGGTATGAACGATAAAGGCATTGGC
TGTCTTTCTCATTGATTGACCCCGTCCTTCGGTGAATACTCATCAGCTAACCCATATCTAGACGAATATCAAGTC
CTGCTGGACAAGCGACCCGTCCGAACCCCGACGAAAGAAGTCCTGACTATTCCCTCCACAAAGCCCCACCTCGCC
CACGCTATTGCACTGGAGTGGGATGTGATGGCCTCCGCCCAGGAGGCTCTTAAAAGCCACCTCATCCCTATGACC
TCCCTCGCAGCCCGCGCCACCGATATCGCCCGTGAAGATGCCGAGGGCAAAAACACCACCAGAAAACAGATTCTC
ACAACCGCCATGCGTTACCTAGATACGGATACCCTACTCTGCTGGGAGCCCGAGCGAGAAATGCACGTGCTGGAG
CGGACGGCGGCCGATGGAACGCCCATCGAGAGTCTTCGCCAGATTCAAACGAGAATTGCCGGCAACGTCATGAGC
TTTTTGTCCACTAAGGTCTGGCCTGGCCTTGAAATCATCCCTATCCTCGACGCCAATAGCATTCTTCCTCTCGCC
CAGCCGAAGGGTACGAAAGACAGTATCGGCACTTGGGTTTCGGGACTGTCTGCGTATGATCTGGCCGGTCTGGAG
CGCGCAATCATTGCTTCCAAGAGTCTTCTCATTGCGGTGCGCCTGGTGGTGGAATGGAGTGAGAACTTCCGCCAT
CTTCAGCGACCTGAGACGAAGAGGTTCGGTATCGAGGAGGCGGCTGAGGCGTCGAGTCTGGAGGTGACCTGGCAG
ACTAACCAATGGGGCGAGGTAGAGGATACCCACGATGTTGGCAAGGAAGACTTGAAGCGACAGTTGGGTAGTGTT
GTGATCTTGGTTAGTGGAGAGACTCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail