Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g726.t1
Gene name
Locationscaffold_01:1873466..1874106
Strand+
Gene length (bp)640
Transcript length (bp)312
Coding sequence length (bp)312
Protein length (aa) 104

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00166 Cpn10 Chaperonin 10 Kd subunit 1.2E-28 10 101

GO

GO Term Description Terminal node
GO:0006457 protein folding Yes
GO:0008150 biological_process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g726.t1
MSVLRNIKSLAPLLDRVLVQRIKPEAKTASGIFLPEAAVKEQNEAQVLAVGPGLLDRDGKRLPMGVSAGDKVLIP
QFGGNAIKVGEEEYTLFRDHDILAKIKE*
Coding >Pro_DTO377G3_2|g726.t1
ATGTCTGTCCTCCGCAACATCAAGTCCCTCGCTCCCCTCCTGGACCGCGTCCTGGTCCAGCGCATCAAGCCCGAG
GCCAAGACTGCCTCCGGTATCTTCCTCCCCGAGGCTGCCGTGAAGGAGCAGAACGAGGCTCAGGTCCTCGCCGTT
GGCCCCGGTCTCCTCGACCGTGACGGCAAGCGTCTCCCCATGGGTGTCAGCGCCGGTGACAAGGTCCTCATTCCC
CAGTTCGGTGGTAACGCCATCAAGGTCGGCGAGGAGGAGTACACCCTCTTCCGGGATCACGATATCCTGGCCAAG
ATCAAGGAGTAA
Transcript >Pro_DTO377G3_2|g726.t1
ATGTCTGTCCTCCGCAACATCAAGTCCCTCGCTCCCCTCCTGGACCGCGTCCTGGTCCAGCGCATCAAGCCCGAG
GCCAAGACTGCCTCCGGTATCTTCCTCCCCGAGGCTGCCGTGAAGGAGCAGAACGAGGCTCAGGTCCTCGCCGTT
GGCCCCGGTCTCCTCGACCGTGACGGCAAGCGTCTCCCCATGGGTGTCAGCGCCGGTGACAAGGTCCTCATTCCC
CAGTTCGGTGGTAACGCCATCAAGGTCGGCGAGGAGGAGTACACCCTCTTCCGGGATCACGATATCCTGGCCAAG
ATCAAGGAGTAA
Gene >Pro_DTO377G3_2|g726.t1
ATGGTACGTTGAACATCCCAATTGATGCCAGACCCCGATATTCCCTATTTCCTTAACTCCCGGAGCATGCTAGCA
CCTCAACTCCCAACTTTTCCTTCCTCCAGGCCGAGTCCGGCTATCCGAAAACCCGCGCGCGATCCCCAATTCAGT
CCGGATGTCTCATTGAGAAACATATTCACTAACTCGTCCCCTTCACAGTCTGTCCTCCGCAACATCAAGTCCCTC
GCTCCCCTCCTGGACCGCGTCCTGGTCCAGCGCATCAAGCCCGAGGCCAAGACTGCCTCCGGTATCTTCCTCCCC
GAGGCTGCCGTGAAGGAGCAGAACGAGGCTCAGGTCCTCGCCGTTGGCCCCGGTCTCCTCGACCGTGACGGCAAG
CGTCTCCCCATGGGTGTCAGCGCCGGTGACAAGGTCCTCATTCCCCAGGTATGTGGTGCAACAATTCCTTCGAAA
TACACGGAACATTATATACTAACGTGTCTGTGCTCAGTTCGGTGGTAACGCCATCAAGGTCGGCGAGGAGGAGTA
CACCCTCTTCCGGGATCACGAGTATGTTTCCTCTCTCTCCCTCTCACTCCCTTTTTTTTGCCGAGAACAACAACT
GACAACCTCATCTAGTATCCTGGCCAAGATCAAGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail