Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7258.t1
Gene name
Locationscaffold_22:60407..61275
Strand+
Gene length (bp)868
Transcript length (bp)789
Coding sequence length (bp)789
Protein length (aa) 263

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08193 INO80_Ies4 INO80 complex subunit Ies4 1.5E-63 5 237

GO

GO Term Description Terminal node
GO:0006338 chromatin remodeling Yes
GO:0031011 Ino80 complex Yes
GO:0032991 protein-containing complex No
GO:0044464 cell part No
GO:0006325 chromatin organization No
GO:0016043 cellular component organization No
GO:1904949 ATPase complex No
GO:0044446 intracellular organelle part No
GO:0044427 chromosomal part No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0071840 cellular component organization or biogenesis No
GO:0097346 INO80-type complex No
GO:0070603 SWI/SNF superfamily-type complex No
GO:0008150 biological_process No
GO:0044428 nuclear part No
GO:0044454 nuclear chromosome part No
GO:0044422 organelle part No
GO:0044424 intracellular part No
GO:0033202 DNA helicase complex No
GO:1902494 catalytic complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7258.t1
MPAATPNGRSRGAKNSPNSLMVVLKLSGDALQQFASPSKSQNNTPNIKSNDNSSPASSAELPTVRPSSADNGSDA
DANSTPATGATAGDAQRRKGVPGPKPGNKRTKDQTDPTAKSRGRPGPKKKPRLDEGEATKIPAAQRLGPKANTGA
INAGLRALDRTGAACRKWERKPLQLRSFTGILWQLPSWRTPGMPKSGDAVNGKVAALESGDSDTKTTLHAPGTDT
ANGSSAVPSEKSNSGDGDVTPTSHLVEPSSPAIAMTA*
Coding >Pro_DTO377G3_2|g7258.t1
ATGCCCGCCGCTACTCCAAATGGTCGCTCACGCGGAGCCAAGAATTCACCCAACTCCTTGATGGTGGTTCTCAAG
CTATCTGGGGATGCCCTCCAGCAGTTCGCCAGTCCCAGCAAGAGCCAAAATAATACTCCCAACATTAAATCCAAC
GACAACTCTTCACCAGCCTCCTCCGCCGAGCTCCCTACTGTCCGCCCATCTTCTGCCGATAATGGCTCCGACGCC
GACGCCAATTCTACGCCCGCCACAGGGGCGACTGCAGGCGATGCACAACGTCGGAAGGGAGTTCCGGGTCCTAAG
CCAGGAAACAAAAGAACAAAAGACCAAACCGACCCTACCGCAAAGTCACGGGGACGCCCTGGCCCCAAGAAGAAA
CCCAGACTTGACGAAGGCGAAGCCACAAAGATTCCAGCTGCACAGCGTCTGGGACCAAAAGCCAATACGGGAGCC
ATCAACGCCGGTCTGCGCGCGCTAGATCGCACCGGAGCCGCGTGTCGCAAATGGGAGCGCAAGCCCCTACAGCTC
CGCAGCTTCACCGGCATTTTGTGGCAACTTCCATCCTGGCGCACACCGGGTATGCCCAAGTCCGGTGACGCGGTT
AATGGCAAGGTTGCAGCGCTGGAAAGTGGCGACAGCGACACAAAGACCACGCTTCATGCCCCCGGCACCGACACG
GCCAATGGCAGCAGTGCTGTGCCTAGTGAGAAGAGCAACTCTGGGGATGGCGATGTCACCCCTACTTCTCATCTA
GTCGAGCCCTCCTCGCCAGCCATTGCTATGACAGCTTGA
Transcript >Pro_DTO377G3_2|g7258.t1
ATGCCCGCCGCTACTCCAAATGGTCGCTCACGCGGAGCCAAGAATTCACCCAACTCCTTGATGGTGGTTCTCAAG
CTATCTGGGGATGCCCTCCAGCAGTTCGCCAGTCCCAGCAAGAGCCAAAATAATACTCCCAACATTAAATCCAAC
GACAACTCTTCACCAGCCTCCTCCGCCGAGCTCCCTACTGTCCGCCCATCTTCTGCCGATAATGGCTCCGACGCC
GACGCCAATTCTACGCCCGCCACAGGGGCGACTGCAGGCGATGCACAACGTCGGAAGGGAGTTCCGGGTCCTAAG
CCAGGAAACAAAAGAACAAAAGACCAAACCGACCCTACCGCAAAGTCACGGGGACGCCCTGGCCCCAAGAAGAAA
CCCAGACTTGACGAAGGCGAAGCCACAAAGATTCCAGCTGCACAGCGTCTGGGACCAAAAGCCAATACGGGAGCC
ATCAACGCCGGTCTGCGCGCGCTAGATCGCACCGGAGCCGCGTGTCGCAAATGGGAGCGCAAGCCCCTACAGCTC
CGCAGCTTCACCGGCATTTTGTGGCAACTTCCATCCTGGCGCACACCGGGTATGCCCAAGTCCGGTGACGCGGTT
AATGGCAAGGTTGCAGCGCTGGAAAGTGGCGACAGCGACACAAAGACCACGCTTCATGCCCCCGGCACCGACACG
GCCAATGGCAGCAGTGCTGTGCCTAGTGAGAAGAGCAACTCTGGGGATGGCGATGTCACCCCTACTTCTCATCTA
GTCGAGCCCTCCTCGCCAGCCATTGCTATGACAGCTTGA
Gene >Pro_DTO377G3_2|g7258.t1
ATGCCCGCCGCTACTCCAAATGGTCGCTCACGCGGAGCCAAGAATTCACCCAACTCCTTGATGGTGGTTCTCAAG
CTATCTGGGGATGCCCTCCAGCAGTTCGCCAGTCCCAGCAAGAGCCAAAATAATACTCCCAACATTAAATCCAAC
GACAACTCTTCACCAGCCTCCTCCGCCGAGCTCCCTACTGTCCGCCCATCTTCTGCCGATAATGGCTCCGACGCC
GACGCCAATTCTACGCCCGCCACAGGGGCGACTGCAGGCGATGCACAACGTCGGAAGGGAGTTCCGGGTCCTAAG
CCAGGAAACAAAAGAACAAAAGACCAAACCGACCCTACCGCAAAGTCACGGGGACGCCCTGGCCCCAAGAAGAAA
CCCAGACTGTAAGCCAACCCGACACATTTTCGAATGAGCATAATTCCAGAAAAGAAAATAGTCGAACTAACATAT
CATCGATCTTAGTGACGAAGGCGAAGCCACAAAGATTCCAGCTGCACAGCGTCTGGGACCAAAAGCCAATACGGG
AGCCATCAACGCCGGTCTGCGCGCGCTAGATCGCACCGGAGCCGCGTGTCGCAAATGGGAGCGCAAGCCCCTACA
GCTCCGCAGCTTCACCGGCATTTTGTGGCAACTTCCATCCTGGCGCACACCGGGTATGCCCAAGTCCGGTGACGC
GGTTAATGGCAAGGTTGCAGCGCTGGAAAGTGGCGACAGCGACACAAAGACCACGCTTCATGCCCCCGGCACCGA
CACGGCCAATGGCAGCAGTGCTGTGCCTAGTGAGAAGAGCAACTCTGGGGATGGCGATGTCACCCCTACTTCTCA
TCTAGTCGAGCCCTCCTCGCCAGCCATTGCTATGACAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail