Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7255.t1
Gene name
Locationscaffold_22:54798..56617
Strand+
Gene length (bp)1819
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 4.7E-46 133 442
PF00355 Rieske Rieske [2Fe-2S] domain 5.5E-16 31 96
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 2.7E-12 274 344

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0051537 2 iron, 2 sulfur cluster binding Yes
GO:0005488 binding No
GO:0051540 metal cluster binding No
GO:0051536 iron-sulfur cluster binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 376.09 214.23 537.95
5d_25C Five days - 25 degrees Celsius 436.56 245.03 628.09
7d_25C Seven days - 25 degrees Celsius 439.56 243.83 635.30
10d_25C Ten days - 25 degrees Celsius 537.16 295.84 778.49
7d_15C Seven days - 15 degrees Celsius 679.30 350.96 1007.65
7d_30C Seven days - 30 degrees Celsius 323.14 184.03 462.25

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.621082 no
3d_25C 7d_25C 0.604378 no
3d_25C 7d_15C 0.011993 yes
3d_25C 7d_30C 0.610148 no
3d_25C 10d_25C 0.153493 no
5d_25C 7d_25C 0.987005 no
5d_25C 7d_15C 0.077331 no
5d_25C 7d_30C 0.241443 no
5d_25C 10d_25C 0.477318 no
7d_25C 7d_15C 0.077499 no
7d_25C 7d_30C 0.221110 no
7d_25C 10d_25C 0.490193 no
7d_15C 7d_30C 0.003197 yes
7d_15C 10d_25C 0.420246 no
7d_30C 10d_25C 0.028642 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7255.t1
MPQEYKLKDISSFASLNSLDKVEVEIEGIEDGKVLLVKLNDKVYALSPRCTHYGAPLKNGVVTAEGRITCPWHGA
CYNVATGDVEDAPAPNALNKFEVFERAGGVYILAKEEDVKAGQRNPVVKCTVSQPKEKVVVIGGGSGTLGLIQAL
RELKYPGAITIISKEPDLIIDRTKLSKALITDAAKIQWRPREWYAEAAIETITDEVTAVDFEQKSISTKSGQNIP
YTKLVLASGGTPRRLPLQGFKGELKNVFTLRTIQDVRSILAAAGEERRNIVVIGSSFIGMEVGNALSKSHNVTIV
GMETSPMERVMGAQVGRIFQSNLEKAGIKFHLSANVSHATASSSDPHTVGTVHLKNGTSLPADLVIQGVGVRPAT
DFLHDNKSITLEKDGSVKTTPHFVVPGLQDSVFAVGDIATYPYHGPGADPAGSPVRIEHWDVAQNAGRAAARAIV
HALCGPLSSLKHKVFIPVFWSALGAQLRYCGNPINGYDDVILQEKGEAKFVAFYTAGETVVAVATMGVDPVMVKS
AELMRVGKMPSKGDIAGGTDVLSLKV*
Coding >Pro_DTO377G3_2|g7255.t1
ATGCCCCAGGAATACAAACTAAAGGACATCTCCTCCTTCGCATCCCTCAACTCTCTAGACAAGGTCGAGGTTGAA
ATCGAAGGCATTGAGGATGGGAAGGTTCTCCTCGTGAAGCTGAACGATAAAGTCTATGCCCTTAGTCCACGGTGC
ACGCATTACGGAGCACCACTGAAGAATGGCGTTGTCACTGCAGAAGGGAGGATTACATGTCCCTGGCATGGAGCC
TGCTACAATGTCGCAACTGGCGATGTTGAAGATGCTCCAGCTCCCAACGCGCTGAACAAATTCGAGGTCTTCGAA
AGAGCAGGCGGCGTCTACATCCTTGCCAAAGAAGAAGATGTCAAAGCAGGACAGCGCAATCCAGTTGTGAAATGC
ACTGTGTCACAGCCAAAGGAGAAGGTTGTTGTGATTGGAGGAGGAAGTGGAACTCTTGGCCTTATCCAAGCTCTC
CGCGAGCTAAAATACCCCGGGGCGATCACAATCATCTCCAAAGAGCCCGATCTGATCATAGATCGAACCAAGCTA
TCCAAAGCCCTAATCACGGACGCAGCCAAAATCCAATGGCGACCACGAGAGTGGTATGCTGAAGCCGCCATAGAA
ACTATCACAGATGAAGTGACTGCCGTGGACTTCGAACAGAAATCCATCTCCACCAAATCCGGCCAAAACATCCCC
TACACCAAACTAGTCCTAGCATCAGGCGGCACCCCACGCAGACTCCCGCTACAAGGCTTCAAAGGCGAGCTCAAG
AACGTCTTCACCCTTCGCACCATCCAAGATGTCCGATCAATCCTCGCAGCAGCCGGCGAAGAGAGAAGAAACATC
GTGGTAATCGGCAGCTCCTTCATCGGCATGGAAGTCGGCAACGCGCTCTCAAAATCCCACAATGTGACAATAGTA
GGCATGGAAACCTCGCCAATGGAGCGTGTAATGGGCGCACAAGTCGGCCGCATCTTCCAATCAAACCTAGAAAAA
GCCGGCATCAAATTCCACCTCTCAGCGAACGTGAGCCATGCTACAGCCTCCTCCTCAGATCCGCACACCGTCGGT
ACTGTCCATCTAAAGAACGGAACAAGCCTCCCAGCCGACCTTGTCATTCAAGGCGTGGGCGTCCGCCCAGCGACA
GACTTCCTTCACGACAACAAATCCATAACCCTTGAGAAAGACGGCTCCGTCAAAACAACCCCCCACTTCGTCGTG
CCGGGCTTGCAAGACTCCGTCTTCGCCGTCGGCGATATAGCAACATACCCCTACCACGGTCCCGGCGCTGACCCT
GCCGGCTCGCCAGTCCGCATCGAGCACTGGGACGTCGCGCAGAACGCGGGCCGTGCTGCTGCACGAGCAATCGTG
CATGCGCTGTGTGGTCCGCTGTCGTCCCTGAAACATAAGGTGTTTATTCCGGTGTTTTGGTCCGCGCTTGGGGCG
CAGTTGCGGTACTGTGGAAATCCCATTAACGGGTATGACGATGTTATTTTGCAGGAGAAGGGGGAGGCGAAATTC
GTTGCGTTCTATACGGCTGGAGAGACCGTTGTGGCGGTTGCCACTATGGGAGTTGATCCGGTTATGGTTAAGTCT
GCAGAGCTGATGAGAGTCGGGAAGATGCCGAGCAAGGGAGATATTGCTGGTGGTACGGATGTTTTGAGTCTTAAG
GTTTAG
Transcript >Pro_DTO377G3_2|g7255.t1
ATGCCCCAGGAATACAAACTAAAGGACATCTCCTCCTTCGCATCCCTCAACTCTCTAGACAAGGTCGAGGTTGAA
ATCGAAGGCATTGAGGATGGGAAGGTTCTCCTCGTGAAGCTGAACGATAAAGTCTATGCCCTTAGTCCACGGTGC
ACGCATTACGGAGCACCACTGAAGAATGGCGTTGTCACTGCAGAAGGGAGGATTACATGTCCCTGGCATGGAGCC
TGCTACAATGTCGCAACTGGCGATGTTGAAGATGCTCCAGCTCCCAACGCGCTGAACAAATTCGAGGTCTTCGAA
AGAGCAGGCGGCGTCTACATCCTTGCCAAAGAAGAAGATGTCAAAGCAGGACAGCGCAATCCAGTTGTGAAATGC
ACTGTGTCACAGCCAAAGGAGAAGGTTGTTGTGATTGGAGGAGGAAGTGGAACTCTTGGCCTTATCCAAGCTCTC
CGCGAGCTAAAATACCCCGGGGCGATCACAATCATCTCCAAAGAGCCCGATCTGATCATAGATCGAACCAAGCTA
TCCAAAGCCCTAATCACGGACGCAGCCAAAATCCAATGGCGACCACGAGAGTGGTATGCTGAAGCCGCCATAGAA
ACTATCACAGATGAAGTGACTGCCGTGGACTTCGAACAGAAATCCATCTCCACCAAATCCGGCCAAAACATCCCC
TACACCAAACTAGTCCTAGCATCAGGCGGCACCCCACGCAGACTCCCGCTACAAGGCTTCAAAGGCGAGCTCAAG
AACGTCTTCACCCTTCGCACCATCCAAGATGTCCGATCAATCCTCGCAGCAGCCGGCGAAGAGAGAAGAAACATC
GTGGTAATCGGCAGCTCCTTCATCGGCATGGAAGTCGGCAACGCGCTCTCAAAATCCCACAATGTGACAATAGTA
GGCATGGAAACCTCGCCAATGGAGCGTGTAATGGGCGCACAAGTCGGCCGCATCTTCCAATCAAACCTAGAAAAA
GCCGGCATCAAATTCCACCTCTCAGCGAACGTGAGCCATGCTACAGCCTCCTCCTCAGATCCGCACACCGTCGGT
ACTGTCCATCTAAAGAACGGAACAAGCCTCCCAGCCGACCTTGTCATTCAAGGCGTGGGCGTCCGCCCAGCGACA
GACTTCCTTCACGACAACAAATCCATAACCCTTGAGAAAGACGGCTCCGTCAAAACAACCCCCCACTTCGTCGTG
CCGGGCTTGCAAGACTCCGTCTTCGCCGTCGGCGATATAGCAACATACCCCTACCACGGTCCCGGCGCTGACCCT
GCCGGCTCGCCAGTCCGCATCGAGCACTGGGACGTCGCGCAGAACGCGGGCCGTGCTGCTGCACGAGCAATCGTG
CATGCGCTGTGTGGTCCGCTGTCGTCCCTGAAACATAAGGTGTTTATTCCGGTGTTTTGGTCCGCGCTTGGGGCG
CAGTTGCGGTACTGTGGAAATCCCATTAACGGGTATGACGATGTTATTTTGCAGGAGAAGGGGGAGGCGAAATTC
GTTGCGTTCTATACGGCTGGAGAGACCGTTGTGGCGGTTGCCACTATGGGAGTTGATCCGGTTATGGTTAAGTCT
GCAGAGCTGATGAGAGTCGGGAAGATGCCGAGCAAGGGAGATATTGCTGGTGGTACGGATGTTTTGAGTCTTAAG
GTTTAG
Gene >Pro_DTO377G3_2|g7255.t1
ATGCCCCAGGAATACAAACTAAAGGACATCTCCTCCTTCGCATCCCTCAACTCTCTAGACAAGGTCGAGGTTGAA
ATCGAAGGCATTGAGGATGGGAAGGTTCTCCTCGTGAAGCTGAACGATAAAGTCTATGCCCTTAGTCCACGGTGC
ACGCATTACGGAGCACCACTGAAGAATGGCGTTGTCACTGCAGAAGGGAGGATTACATGTCCCTGGCATGGAGGT
GAGATGCTTGTTTGAGTTTCTTTTGGTTAGGGGAAAGAAAAGAACAAAATACTAACTACTATATCTACAGCCTGC
TACAATGTCGCAACTGGCGATGTTGAAGATGCTCCAGCTCCCAACGCGCTGAACAAATTCGAGGTCTTCGAAAGA
GCAGGCGGCGTCTACATCCTTGCCAAAGAAGAAGATGTCAAAGCAGGACAGCGCAATCCAGTTGTGAAATGCACT
GTGTCACAGCCAAAGGAGAAGGTTGTTGTGATTGGAGGGTAAGTCACCCTTTTTTCCTTCATCACTATGCACATG
TTTCTACATTTCCTCTCGTTCGAATAATTGGATACCCATACTAACAACAAACAGAGGAAGTGGAACTCTTGGCCT
TATCCAAGCTCTCCGCGAGCTAAAATACCCCGGGGCGATCACAATCATCTCCAAAGAGCCCGATCTGATCATAGA
TCGAACCAAGCTATCCAAAGCCCTAATCACGGACGCAGCCAAAATCCAATGGCGACCACGAGAGTGGTATGCTGA
AGCCGCCATAGAAACTATCACAGATGAAGTGACTGCCGTGGACTTCGAACAGAAATCCATCTCCACCAAATCCGG
CCAAAACATCCCCTACACCAAACTAGTCCTAGCATCAGGCGGCACCCCACGCAGACTCCCGCTACAAGGCTTCAA
AGGCGAGCTCAAGAACGTCTTCACCCTTCGCACCATCCAAGATGTCCGATCAATCCTCGCAGCAGCCGGCGAAGA
GAGAAGAAACATCGTGGTAATCGGCAGCTCCTTCATCGGCATGGAAGTCGGCAACGCGCTCTCAAAATCCCACAA
TGTGACAATAGTAGGCATGGAAACCTCGCCAATGGAGCGTGTAATGGGCGCACAAGTCGGCCGCATCTTCCAATC
AAACCTAGAAAAAGCCGGCATCAAATTCCACCTCTCAGCGAACGTGAGCCATGCTACAGCCTCCTCCTCAGATCC
GCACACCGTCGGTACTGTCCATCTAAAGAACGGAACAAGCCTCCCAGCCGACCTTGTCATTCAAGGCGTGGGCGT
CCGCCCAGCGACAGACTTCCTTCACGACAACAAATCCATAACCCTTGAGAAAGACGGCTCCGTCAAAACAACCCC
CCACTTCGTCGTGCCGGGCTTGCAAGACTCCGTCTTCGCCGTCGGCGATATAGCAACATACCCCTACCACGGTCC
CGGCGCTGACCCTGCCGGCTCGCCAGTCCGCATCGAGCACTGGGACGTCGCGCAGAACGCGGGCCGTGCTGCTGC
ACGAGCAATCGTGCATGCGCTGTGTGGTCCGCTGTCGTCCCTGAAACATAAGGTGTTTATTCCGGTGTTTTGGTC
CGCGCTTGGGGCGCAGTTGCGGTACTGTGGAAATCCCATTAACGGGTATGACGATGTTATTTTGCAGGAGAAGGG
GGAGGCGAAATTCGTTGCGTTCTATACGGCTGGAGAGACCGTTGTGGCGGTTGCCACTATGGGAGTTGATCCGGT
TATGGTTAAGTCTGCAGAGCTGATGAGAGTCGGGAAGATGCCGAGCAAGGGAGATATTGCTGGTGGTACGGATGT
TTTGAGTCTTAAGGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail