Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7244.t1
Gene name
Locationscaffold_22:30779..31841
Strand-
Gene length (bp)1062
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.5

Transmembrane Domains

Domain # Start End Length
1 17 39 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 19.98 8.64 31.33
5d_25C Five days - 25 degrees Celsius 18.96 7.93 29.98
7d_25C Seven days - 25 degrees Celsius 18.61 7.83 29.38
10d_25C Ten days - 25 degrees Celsius 18.72 7.94 29.50
7d_15C Seven days - 15 degrees Celsius 37.08 18.43 55.74
7d_30C Seven days - 30 degrees Celsius 15.10 5.97 24.24

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.914818 no
3d_25C 7d_25C 0.880779 no
3d_25C 7d_15C 0.027043 yes
3d_25C 7d_30C 0.455679 no
3d_25C 10d_25C 0.892188 no
5d_25C 7d_25C 0.971202 no
5d_25C 7d_15C 0.018838 yes
5d_25C 7d_30C 0.576305 no
5d_25C 10d_25C 0.981761 no
7d_25C 7d_15C 0.014096 yes
7d_25C 7d_30C 0.614556 no
7d_25C 10d_25C 0.991911 no
7d_15C 7d_30C 0.002761 yes
7d_15C 10d_25C 0.018560 yes
7d_30C 10d_25C 0.601837 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7244.t1
MPRPRSGLMFPRRITAIFTSSLIVCALLLVYSYLNSVLIDQPSQKHFLWTVESHLYSSTVRKLYNPYIHPITRTI
FIGRTGKAFWVAEPLRFTEPLGKKILILDADSRDLDGPQGLLSKVPLNATGLPPDVSGRLNHYMFAMIHGYDYRL
VQIPRAVGRSGTWIKVTAIKEALEHYEYVVFMDSDAMMPYPNLPMEWLFNYWEITPETLVAMALDPEAPHNLDWN
GRTFLNTGFIIAQQSPRTHELFEAWDDCPTETRYPDCAKWGREWPHEQSAFGNHVRGKWVPRGRSYGMCRGVGEA
LLG*
Coding >Pro_DTO377G3_2|g7244.t1
ATGCCTCGTCCAAGGTCAGGACTCATGTTTCCTCGCCGAATAACCGCTATTTTTACTTCGAGTCTGATCGTGTGT
GCGCTGCTTTTGGTATACTCCTACTTGAACAGTGTATTAATCGATCAGCCGTCCCAGAAGCACTTCCTATGGACC
GTCGAAAGCCACTTATACTCCTCCACGGTCCGCAAACTATACAATCCCTACATACACCCCATTACTAGAACCATA
TTTATTGGCCGCACAGGGAAAGCCTTCTGGGTTGCGGAGCCATTAAGGTTCACCGAACCATTAGGAAAGAAGATC
CTCATTTTGGACGCCGATAGTCGGGATCTTGATGGCCCTCAAGGTCTTTTGAGCAAGGTTCCATTGAACGCGACT
GGACTTCCTCCGGATGTCAGTGGAAGACTCAACCATTACATGTTCGCAATGATCCATGGCTACGATTACCGACTA
GTTCAGATCCCCAGAGCAGTCGGGCGAAGTGGAACATGGATCAAAGTCACCGCCATCAAAGAAGCGTTGGAACAC
TACGAATACGTTGTATTCATGGATTCAGACGCCATGATGCCGTACCCCAATCTACCCATGGAATGGCTATTCAAC
TACTGGGAGATCACTCCGGAGACTCTGGTTGCCATGGCGCTCGATCCAGAAGCACCTCACAACCTTGATTGGAAC
GGCCGGACATTTCTCAACACTGGATTTATTATTGCCCAGCAAAGCCCTCGCACCCATGAACTCTTTGAGGCGTGG
GACGATTGTCCCACTGAAACGCGCTATCCAGACTGCGCTAAATGGGGCCGAGAATGGCCACATGAGCAATCTGCA
TTTGGGAACCACGTCAGAGGCAAATGGGTGCCCAGGGGTCGCAGCTACGGGATGTGTCGGGGAGTTGGTGAGGCA
CTATTGGGGTGA
Transcript >Pro_DTO377G3_2|g7244.t1
ATGCCTCGTCCAAGGTCAGGACTCATGTTTCCTCGCCGAATAACCGCTATTTTTACTTCGAGTCTGATCGTGTGT
GCGCTGCTTTTGGTATACTCCTACTTGAACAGTGTATTAATCGATCAGCCGTCCCAGAAGCACTTCCTATGGACC
GTCGAAAGCCACTTATACTCCTCCACGGTCCGCAAACTATACAATCCCTACATACACCCCATTACTAGAACCATA
TTTATTGGCCGCACAGGGAAAGCCTTCTGGGTTGCGGAGCCATTAAGGTTCACCGAACCATTAGGAAAGAAGATC
CTCATTTTGGACGCCGATAGTCGGGATCTTGATGGCCCTCAAGGTCTTTTGAGCAAGGTTCCATTGAACGCGACT
GGACTTCCTCCGGATGTCAGTGGAAGACTCAACCATTACATGTTCGCAATGATCCATGGCTACGATTACCGACTA
GTTCAGATCCCCAGAGCAGTCGGGCGAAGTGGAACATGGATCAAAGTCACCGCCATCAAAGAAGCGTTGGAACAC
TACGAATACGTTGTATTCATGGATTCAGACGCCATGATGCCGTACCCCAATCTACCCATGGAATGGCTATTCAAC
TACTGGGAGATCACTCCGGAGACTCTGGTTGCCATGGCGCTCGATCCAGAAGCACCTCACAACCTTGATTGGAAC
GGCCGGACATTTCTCAACACTGGATTTATTATTGCCCAGCAAAGCCCTCGCACCCATGAACTCTTTGAGGCGTGG
GACGATTGTCCCACTGAAACGCGCTATCCAGACTGCGCTAAATGGGGCCGAGAATGGCCACATGAGCAATCTGCA
TTTGGGAACCACGTCAGAGGCAAATGGGTGCCCAGGGGTCGCAGCTACGGGATGTGTCGGGGAGTTGGTGAGGCA
CTATTGGGGTGA
Gene >Pro_DTO377G3_2|g7244.t1
ATGCCTCGTCCAAGGTCAGGACTCATGTTTCCTCGCCGAATAACCGCTATTTTTACTTCGAGTCTGATCGTGTGT
GCGCTGCTTTTGGTATACTCCTACTTGAACAGTGTATTAATCGATCAGCCGTCCCAGTACGAGCCCACGCAAAGC
AAAATGTTGAAGTTGAGGACTGACTCTAGTATAGGAAGCACTTCCTATGGACCGTCGAAAGCCACTTATACTCCT
CCACGGTCCGCAAACTATACAATCCCTACATACACCCCATTACTAGAACCATATTTATTGGCCGCACAGGGAAAG
CCTTCTGGGTTGCGGAGCCATTAAGGTTCACCGAACCATTAGGAAAGAAGATCCTCATTTTGGACGCCGATAGTC
GGGATCTTGATGGCCCTCAAGGTCTTTTGAGCAAGGTTCCATTGAACGCGACTGGACTTCCTCCGGATGTCAGTG
GAAGACTCAACCATTACATGTTCGGTAAGTAGTCACACTTCTATCTGTTCCTACGGTGTGATTGACTAGCATAGC
AATGATCCATGGCTACGATTACCGACTAGTTCAGATCCCCAGAGCAGTCGGGCGAAGTGGAACATGGATCAAAGT
CACCGCCATCAAAGAAGCGTTGGAACACTACGAATACGTTGTATTCATGGATTCAGACGCCATGATGCCGTACCC
CAATCTACCCATGGAATGGCTATTCAACTACTGGGAGATCACTCCGGAGACTCTGGTTGCCATGGCGCTCGATCC
AGAAGCACCTCACAACCTTGATTGGAACGGCCGGACATTTCTCAACACTGGATTTATTATTGCCCAGCAAAGCCC
TCGCACCCATGAACTCTTTGAGGCGTGGGACGATTGTCCCACTGAAACGCGCTATCCAGACTGCGCTAAATGGGG
CCGAGAATGGCCACATGAGCAATCTGCATTTGGGAACCACGTCAGGTATGAATTTAACAGATCGGAGGACATTCG
AGTCCTATCTTGTGCAGAGGCAAATGGGTGCCCAGGGGTCGCAGCTACGGGATGTGTCGGGGAGTTGGTGAGGCA
CTATTGGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail