Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7236.t1
Gene name
Locationscaffold_22:8436..10030
Strand+
Gene length (bp)1594
Transcript length (bp)1395
Coding sequence length (bp)1395
Protein length (aa) 465

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03663 Glyco_hydro_76 Glycosyl hydrolase family 76 3.5E-112 35 398

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 440 462 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 4.24 1.32 7.16
5d_25C Five days - 25 degrees Celsius 3.16 0.64 5.69
7d_25C Seven days - 25 degrees Celsius 3.51 0.86 6.15
10d_25C Ten days - 25 degrees Celsius 1.60 0.22 2.99
7d_15C Seven days - 15 degrees Celsius 1.58 0.19 2.97
7d_30C Seven days - 30 degrees Celsius 5.96 2.05 9.86

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.572942 no
3d_25C 7d_25C 0.723786 no
3d_25C 7d_15C 0.029092 yes
3d_25C 7d_30C 0.426088 no
3d_25C 10d_25C 0.027278 yes
5d_25C 7d_25C 0.878207 no
5d_25C 7d_15C 0.169057 no
5d_25C 7d_30C 0.152904 no
5d_25C 10d_25C 0.168419 no
7d_25C 7d_15C 0.089882 no
7d_25C 7d_30C 0.205242 no
7d_25C 10d_25C 0.088306 no
7d_15C 7d_30C 0.003197 yes
7d_15C 10d_25C 0.985167 no
7d_30C 10d_25C 0.001804 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7236.t1
MRFKGAGHMAIVALRILLFTNQVLALNLDVNNQQSIKDAGSTAAYNMMTWYKENGTDNPGFISRSWWTGAALFLA
CLNYWHATNDTTYNDEVSIGLQHQGGSGGDYMPSWAVGIGNDDQMFWGLAAITAAEYKFPNRPSGDTWLTLAEGV
FNDQISPEGKGWETTICGGGLRWQKEIWQSGYTMKNAVSNGGFFMLAARLAWYTQKNNYATWAAKVYDWSTTVNL
VNNKTWAVADSVRAGSGGPNGCSLPDHTEWTYNYGTYISGAGYMYAYTNDTKWLNITNNLVDSLFTTFFLPQHGG
VITDWECEASDECYKDANGPLFKGLTVSWLADVALIVPFLREKILPKLQVSAQGAANSCTGNNQNLCGNRWYGGY
DGQNSMENAMSGSQIMSAVMLQFLGTSSKPVSTATGGNGTSDPSAGTGERSGPAPLSPITTADRAGAGILTVLFV
ALMLGGVVFLFMDP*
Coding >Pro_DTO377G3_2|g7236.t1
ATGAGGTTCAAAGGTGCCGGGCATATGGCCATAGTGGCGTTGCGCATTCTACTGTTTACAAATCAAGTCTTGGCG
CTCAACCTGGATGTTAACAATCAGCAATCCATCAAAGATGCCGGGAGCACCGCCGCCTACAACATGATGACATGG
TACAAAGAAAATGGGACAGATAACCCGGGTTTCATCTCAAGATCTTGGTGGACAGGAGCTGCTTTGTTTCTAGCA
TGTCTCAATTATTGGCATGCTACAAACGACACAACCTACAACGATGAAGTCAGCATCGGATTACAACATCAGGGG
GGTTCTGGCGGAGACTACATGCCTTCATGGGCAGTAGGCATAGGAAATGATGATCAAATGTTCTGGGGCCTCGCG
GCGATCACCGCAGCAGAATATAAATTCCCGAATCGTCCAAGTGGGGACACCTGGCTCACCCTTGCAGAGGGCGTT
TTCAATGACCAGATATCGCCAGAAGGGAAGGGATGGGAGACGACTATTTGTGGAGGTGGCCTTCGCTGGCAGAAG
GAGATATGGCAAAGTGGTTATACCATGAAGAACGCGGTGTCGAACGGTGGCTTTTTCATGCTCGCGGCTCGTCTC
GCTTGGTATACCCAAAAGAACAACTACGCCACGTGGGCTGCGAAAGTCTACGACTGGTCTACGACGGTGAATTTG
GTCAATAATAAAACCTGGGCAGTGGCAGATAGTGTCAGAGCAGGCTCTGGGGGTCCCAATGGCTGCAGTCTTCCT
GACCACACCGAGTGGACCTACAACTATGGTACCTATATATCTGGTGCTGGCTATATGTATGCCTACACAAACGAT
ACTAAATGGCTTAATATCACAAACAACCTAGTGGATTCATTGTTTACTACATTTTTCCTACCTCAACACGGAGGT
GTGATTACAGACTGGGAGTGCGAAGCTTCGGACGAATGCTACAAAGATGCGAATGGTCCACTTTTCAAAGGCCTT
ACTGTGTCGTGGCTTGCAGATGTTGCATTGATCGTCCCTTTCCTCAGGGAGAAGATCCTACCCAAACTCCAAGTT
TCTGCCCAGGGTGCTGCAAATTCATGCACCGGCAACAACCAAAACCTCTGTGGTAACCGCTGGTACGGCGGGTAT
GATGGGCAAAATTCAATGGAGAATGCAATGAGTGGTAGTCAGATAATGAGTGCTGTTATGCTGCAATTTCTAGGC
ACATCCTCAAAACCAGTCTCGACAGCAACAGGAGGGAACGGCACAAGCGACCCGAGTGCTGGTACTGGGGAAAGG
TCGGGGCCTGCACCGTTGTCGCCTATCACAACGGCAGATAGAGCAGGAGCAGGAATCCTGACAGTGCTTTTCGTG
GCTCTTATGTTAGGCGGAGTGGTCTTTTTGTTTATGGACCCCTGA
Transcript >Pro_DTO377G3_2|g7236.t1
ATGAGGTTCAAAGGTGCCGGGCATATGGCCATAGTGGCGTTGCGCATTCTACTGTTTACAAATCAAGTCTTGGCG
CTCAACCTGGATGTTAACAATCAGCAATCCATCAAAGATGCCGGGAGCACCGCCGCCTACAACATGATGACATGG
TACAAAGAAAATGGGACAGATAACCCGGGTTTCATCTCAAGATCTTGGTGGACAGGAGCTGCTTTGTTTCTAGCA
TGTCTCAATTATTGGCATGCTACAAACGACACAACCTACAACGATGAAGTCAGCATCGGATTACAACATCAGGGG
GGTTCTGGCGGAGACTACATGCCTTCATGGGCAGTAGGCATAGGAAATGATGATCAAATGTTCTGGGGCCTCGCG
GCGATCACCGCAGCAGAATATAAATTCCCGAATCGTCCAAGTGGGGACACCTGGCTCACCCTTGCAGAGGGCGTT
TTCAATGACCAGATATCGCCAGAAGGGAAGGGATGGGAGACGACTATTTGTGGAGGTGGCCTTCGCTGGCAGAAG
GAGATATGGCAAAGTGGTTATACCATGAAGAACGCGGTGTCGAACGGTGGCTTTTTCATGCTCGCGGCTCGTCTC
GCTTGGTATACCCAAAAGAACAACTACGCCACGTGGGCTGCGAAAGTCTACGACTGGTCTACGACGGTGAATTTG
GTCAATAATAAAACCTGGGCAGTGGCAGATAGTGTCAGAGCAGGCTCTGGGGGTCCCAATGGCTGCAGTCTTCCT
GACCACACCGAGTGGACCTACAACTATGGTACCTATATATCTGGTGCTGGCTATATGTATGCCTACACAAACGAT
ACTAAATGGCTTAATATCACAAACAACCTAGTGGATTCATTGTTTACTACATTTTTCCTACCTCAACACGGAGGT
GTGATTACAGACTGGGAGTGCGAAGCTTCGGACGAATGCTACAAAGATGCGAATGGTCCACTTTTCAAAGGCCTT
ACTGTGTCGTGGCTTGCAGATGTTGCATTGATCGTCCCTTTCCTCAGGGAGAAGATCCTACCCAAACTCCAAGTT
TCTGCCCAGGGTGCTGCAAATTCATGCACCGGCAACAACCAAAACCTCTGTGGTAACCGCTGGTACGGCGGGTAT
GATGGGCAAAATTCAATGGAGAATGCAATGAGTGGTAGTCAGATAATGAGTGCTGTTATGCTGCAATTTCTAGGC
ACATCCTCAAAACCAGTCTCGACAGCAACAGGAGGGAACGGCACAAGCGACCCGAGTGCTGGTACTGGGGAAAGG
TCGGGGCCTGCACCGTTGTCGCCTATCACAACGGCAGATAGAGCAGGAGCAGGAATCCTGACAGTGCTTTTCGTG
GCTCTTATGTTAGGCGGAGTGGTCTTTTTGTTTATGGACCCCTGA
Gene >Pro_DTO377G3_2|g7236.t1
ATGAGGTTCAAAGGTGCCGGGCATATGGCCATAGTGGCGTTGCGCATTCTACTGTTTACAAATCAAGTCTTGGCG
CTCAACCTGGATGTTAACAATCAGCGTAAGATAACTATGTTTTCATATCTTTCTAACGGTTGAGTTGCTAATTAC
ATATATTTTCAATGAGTAGAATCCATCAAAGATGCCGGGAGCACCGCCGCCTACAACATGATGACATGGTACAAA
GAAAATGGGACAGATAACCCGGGTTTCATCTCAAGATCTTGGTGGACAGGAGCTGCTTTGTTTCTAGCATGTCTC
AATTATTGGCATGCTACAAACGACACAACCTACAACGATGAAGTCAGCATCGGATTACAACATCAGGGGGGTTCT
GGCGGAGACTACATGCCTTCATGGGCAGTAGGCATAGTAAGTGTCTCTCTCAAGATATGTAGTCAAAGTGCTAAC
CGTTGCATAGGGAAATGATGATCAAATGTTCTGGGGCCTCGCGGCGATCACCGCAGCAGAATATAAATTCCCGAA
TCGTCCAAGTGGGGACACCTGGCTCACCCTTGCAGAGGGCGTTTTCAATGACCAGATATCGCCAGAAGGGAAGGG
ATGGGAGACGACTATTTGTGGAGGTGGCCTTCGCTGGCAGAAGGAGATATGGCAAAGTGGTTATACCATGAAGAA
CGCGGTGTCGAACGGTGGCTTTTTCATGCTCGCGGCTCGTCTCGCTTGGTATACCCAAAAGAACAACTACGCCAC
GTGGGCTGCGAAAGTCTACGACTGGTCTACGACGGTGAATTTGGTCAATAATAAAACCTGGGCAGTGGCAGATAG
TGTCAGAGCAGGCTCTGGGGGTCCCAATGGCTGCAGTCTTCCTGACCACACCGAGTGGACCTACAACTATGGTAC
CTATATATCTGGTGCTGGCTATATGTATGCCTACGTAAGTATTTTTATCCCCCACCCTTTAGTAAATCAGAACTA
CACTCCTGTCTTGGCATGCTAATAACAAACCTCGTTGTAGACAAACGATACTAAATGGCTTAATATCACAAACAA
CCTAGTGGATTCATTGTTTACTACATTTTTCCTACCTCAACACGGAGGTGTGATTACAGACTGGGAGTGCGAAGC
TTCGGACGAATGCTACAAAGATGCGAATGGTCCACTTTTCAAAGGCCTTACTGTGTCGTGGCTTGCAGATGTTGC
ATTGATCGTCCCTTTCCTCAGGGAGAAGATCCTACCCAAACTCCAAGTTTCTGCCCAGGGTGCTGCAAATTCATG
CACCGGCAACAACCAAAACCTCTGTGGTAACCGCTGGTACGGCGGGTATGATGGGCAAAATTCAATGGAGAATGC
AATGAGTGGTAGTCAGATAATGAGTGCTGTTATGCTGCAATTTCTAGGCACATCCTCAAAACCAGTCTCGACAGC
AACAGGAGGGAACGGCACAAGCGACCCGAGTGCTGGTACTGGGGAAAGGTCGGGGCCTGCACCGTTGTCGCCTAT
CACAACGGCAGATAGAGCAGGAGCAGGAATCCTGACAGTGCTTTTCGTGGCTCTTATGTTAGGCGGAGTGGTCTT
TTTGTTTATGGACCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail