Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7210.t1
Gene name
Locationscaffold_21:343422..344697
Strand-
Gene length (bp)1275
Transcript length (bp)855
Coding sequence length (bp)855
Protein length (aa) 285

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01459 Porin_3 Eukaryotic porin 1.2E-73 3 277

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0005741 mitochondrial outer membrane Yes
GO:0019867 outer membrane No
GO:0008150 biological_process No
GO:0016020 membrane No
GO:0031966 mitochondrial membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0098588 bounding membrane of organelle No
GO:0031090 organelle membrane No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031968 organelle outer membrane No
GO:0051179 localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7210.t1
MSAPAAFSDIAKATNDLLNKDFYHGAAANLEVKSKAPNGVTFTVKGKSAHEGPIAGQLEAKYVDAPTGLTLTQAW
TTANALDTKLELDNNIAKGLKAEILTQYQPAKQSKGAKLNLYFKQPNLNARAFFDLLNGPSANFDAVLGHEGFLV
GAEGGYDVNKAAITKYSAAVGYSVAQYSAAITASNNLSLFSASYYHRVNAQVEAGAKASWDSTSGNAVGLEVASK
YRLDPSSFAKAKINDRGIAALAYNVLLRPGVTLGLGASFDTQNLNQAAHKVGASFTFES*
Coding >Pro_DTO377G3_2|g7210.t1
ATGTCTGCCCCAGCTGCTTTCTCCGATATCGCCAAGGCGACCAACGATCTCTTGAACAAGGACTTCTACCACGGC
GCTGCCGCCAACCTTGAGGTCAAGTCCAAGGCTCCCAACGGTGTCACCTTCACCGTTAAGGGAAAGTCTGCTCAC
GAGGGCCCCATTGCTGGTCAGCTCGAGGCCAAATACGTTGATGCGCCCACTGGCCTCACCCTCACCCAGGCTTGG
ACCACCGCCAACGCTCTCGACACCAAGCTCGAGCTCGACAACAACATCGCCAAGGGCCTCAAGGCTGAGATCCTT
ACCCAGTACCAGCCCGCTAAGCAGTCCAAGGGTGCTAAGCTCAACCTGTACTTCAAGCAGCCCAACCTGAACGCC
CGTGCCTTCTTCGATCTGCTGAACGGCCCCTCCGCCAACTTCGACGCCGTTCTCGGCCACGAGGGCTTCCTCGTC
GGTGCTGAGGGTGGTTACGACGTCAACAAGGCCGCCATCACCAAGTACTCCGCTGCCGTCGGCTACAGTGTTGCC
CAGTACTCCGCTGCCATCACTGCCAGCAACAACCTGTCCCTTTTCTCCGCCAGCTACTACCACCGCGTCAACGCT
CAGGTTGAGGCCGGTGCCAAGGCTTCTTGGGACTCCACATCCGGCAACGCCGTCGGCCTCGAGGTCGCCAGCAAG
TACCGCCTGGACCCCTCTTCCTTCGCTAAGGCCAAGATCAACGACCGTGGTATTGCCGCTCTGGCTTACAACGTC
CTGCTCCGCCCTGGTGTCACCCTCGGCCTCGGTGCTTCCTTCGATACCCAGAACCTGAACCAGGCTGCCCACAAG
GTCGGCGCCAGCTTCACCTTCGAGTCTTAA
Transcript >Pro_DTO377G3_2|g7210.t1
ATGTCTGCCCCAGCTGCTTTCTCCGATATCGCCAAGGCGACCAACGATCTCTTGAACAAGGACTTCTACCACGGC
GCTGCCGCCAACCTTGAGGTCAAGTCCAAGGCTCCCAACGGTGTCACCTTCACCGTTAAGGGAAAGTCTGCTCAC
GAGGGCCCCATTGCTGGTCAGCTCGAGGCCAAATACGTTGATGCGCCCACTGGCCTCACCCTCACCCAGGCTTGG
ACCACCGCCAACGCTCTCGACACCAAGCTCGAGCTCGACAACAACATCGCCAAGGGCCTCAAGGCTGAGATCCTT
ACCCAGTACCAGCCCGCTAAGCAGTCCAAGGGTGCTAAGCTCAACCTGTACTTCAAGCAGCCCAACCTGAACGCC
CGTGCCTTCTTCGATCTGCTGAACGGCCCCTCCGCCAACTTCGACGCCGTTCTCGGCCACGAGGGCTTCCTCGTC
GGTGCTGAGGGTGGTTACGACGTCAACAAGGCCGCCATCACCAAGTACTCCGCTGCCGTCGGCTACAGTGTTGCC
CAGTACTCCGCTGCCATCACTGCCAGCAACAACCTGTCCCTTTTCTCCGCCAGCTACTACCACCGCGTCAACGCT
CAGGTTGAGGCCGGTGCCAAGGCTTCTTGGGACTCCACATCCGGCAACGCCGTCGGCCTCGAGGTCGCCAGCAAG
TACCGCCTGGACCCCTCTTCCTTCGCTAAGGCCAAGATCAACGACCGTGGTATTGCCGCTCTGGCTTACAACGTC
CTGCTCCGCCCTGGTGTCACCCTCGGCCTCGGTGCTTCCTTCGATACCCAGAACCTGAACCAGGCTGCCCACAAG
GTCGGCGCCAGCTTCACCTTCGAGTCTTAA
Gene >Pro_DTO377G3_2|g7210.t1
ATGTCTGCCCCAGCTGCTTTCTCCGATATCGCCAAGGCGACCAACGATGTACGCACAACTGTTGGGGACAAAACT
CGGAACCTTGGCTAATACCTAATCCCAATAGCTCTTGAACAAGGACTTCTACCACGGCGCTGCCGGTACGTTTCT
GCATGGCATTGCGCCACTCATTGAAGATTAAATAGCTAATCAAAGCTTTTAGCCAACCTTGAGGTCAAGTCCAAG
GCTCCCAACGGTGTCACCTTCACCGTTAAGGGAAAGTCTGCTCACGAGGGCCCCATTGCTGGTCAGGTTAGTTGC
AAAGCTATTTCTGAATCCAGTCATGCAAATTACTAACTAGTGCGCCTATAGCTCGAGGCCAAATACGTTGATGCG
CCCACTGGTAAACGCCCCCTCCAGAAGAAACCTCCAGATCCCGGCGCGCACAAGGCCCGTCTTATGTCATTGATG
TTGGGATGCGGTATTCCAATAGCGCGCCGGGTGAACTTATTTATTTTTTCCGATGCCAAGATACACAGGATTAGG
CTAATATGCTCACTCCGACCAGGCCTCACCCTCACCCAGGCTTGGACCACCGCCAACGCTCTCGACACCAAGCTC
GAGCTCGACAACAACATCGCCAAGGGCCTCAAGGCTGAGATCCTTACCCAGTACCAGCCCGCTAAGCAGTCCAAG
GGTGCTAAGCTCAACCTGTACTTCAAGCAGCCCAACCTGAACGCCCGTGCCTTCTTCGATCTGCTGAACGGCCCC
TCCGCCAACTTCGACGCCGTTCTCGGCCACGAGGGCTTCCTCGTCGGTGCTGAGGGTGGTTACGACGTCAACAAG
GCCGCCATCACCAAGTACTCCGCTGCCGTCGGCTACAGTGTTGCCCAGTACTCCGCTGCCATCACTGCCAGCAAC
AACCTGTCCCTTTTCTCCGCCAGCTACTACCACCGCGTCAACGCTCAGGTTGAGGCCGGTGCCAAGGCTTCTTGG
GACTCCACATCCGGCAACGCCGTCGGCCTCGAGGTCGCCAGCAAGTACCGCCTGGACCCCTCTTCCTTCGCTAAG
GTTCGTTTCACGCGGTTAAACTGCTTATATAACTATGTAGATCACGACTAATCGCGCAATTTTCTCGCAATTTAG
GCCAAGATCAACGACCGTGGTATTGCCGCTCTGGCTTACAACGTCCTGCTCCGCCCTGGTGTCACCCTCGGCCTC
GGTGCTTCCTTCGATACCCAGAACCTGAACCAGGCTGCCCACAAGGTCGGCGCCAGCTTCACCTTCGAGTCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail