Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7200.t1
Gene name
Locationscaffold_21:317922..319916
Strand+
Gene length (bp)1994
Transcript length (bp)1701
Coding sequence length (bp)1701
Protein length (aa) 567

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01490 Aa_trans Transmembrane amino acid transporter protein 7.7E-79 162 550

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 193 215 22
2 238 260 22
3 280 302 22
4 315 334 19
5 354 376 22
6 389 411 22
7 431 453 22
8 473 490 17
9 500 522 22
10 529 551 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7200.t1
MPGDELSEDHLYARNGQDEHEAQSLLSASSEEHDLALHPEPLPSPIPSHNATSSISHSAISQPATDGKRRTPRTM
NRVRFDLDEEPENNRISIERTLSPDDSPDDTLWLEDEDYELGNRGPGTHHSGQSIPLLTNIEAPSVTLATSDDFF
PEDHLENARPRSGMKMAFMNMANSIIGAGIIGQPYALRQAGMAMGIVLLTALTVTVDWTIRLIVVNSKLSGADSF
QATMQHCFGKSGLIAISVAQWAFAFGGMVAFCIIVGDTIPHVLGALFPSLKDMAFLWLFTDRRAVIVIFVLVVSY
PLSLYRDIAKLAKASALAFVSMIVIVVTVITQGFRVPPESRGEIKSHLVFNTGFFQAVGVISFAFVCHHNSLLIY
GSLKKPTLDRFARVTHYSTGISLVMCLAMGIAGFLSFGSKTQGNVLNNFPSDNIVVNIARFCFGLNMLTTLPLEA
FVCRSVMTTYYFPDEPHNTVRHIIFTTALVVTSMVLSLITCDLGSVFELIGATSAAALAYIFPPLCYIKLSSATR
REKIPAYLCICFGVLVMGVSVVQAVIKIIRNDGEAHSCSAR*
Coding >Pro_DTO377G3_2|g7200.t1
ATGCCAGGGGATGAGTTGTCAGAGGATCACCTGTATGCCCGGAATGGCCAGGATGAACATGAAGCCCAATCCCTC
CTGTCTGCTTCAAGCGAGGAGCATGACCTAGCTCTCCATCCGGAGCCTCTTCCGTCGCCGATCCCCTCACATAAC
GCGACAAGTAGCATATCCCACTCCGCGATTTCTCAACCTGCAACCGACGGAAAGCGCCGTACACCCCGTACCATG
AACCGAGTTCGATTCGACCTGGACGAAGAACCTGAAAACAATCGCATTTCCATTGAGCGTACTCTCAGCCCGGAC
GACAGTCCAGATGACACACTATGGCTGGAGGACGAGGACTATGAACTTGGAAACCGAGGCCCAGGGACACACCAC
AGTGGACAATCAATTCCTCTTCTCACAAATATCGAAGCGCCTAGTGTGACACTTGCAACGTCGGACGATTTCTTC
CCCGAAGATCATCTCGAAAATGCGCGGCCGCGGAGTGGGATGAAAATGGCGTTCATGAACATGGCCAACAGCATT
ATCGGCGCTGGGATTATTGGGCAACCTTACGCGCTCCGTCAAGCAGGCATGGCGATGGGAATTGTGCTGCTGACT
GCCTTGACCGTCACAGTGGACTGGACTATTCGATTGATTGTGGTCAACTCTAAATTGAGTGGGGCGGATTCCTTT
CAGGCAACTATGCAGCATTGCTTCGGGAAGAGTGGTCTCATCGCGATCTCAGTTGCACAGTGGGCATTTGCATTC
GGTGGCATGGTCGCATTTTGCATTATTGTTGGCGATACCATTCCACACGTTCTAGGCGCTTTATTTCCGTCTCTT
AAGGATATGGCCTTCCTCTGGCTTTTCACAGACCGCAGGGCGGTTATCGTTATTTTCGTTTTGGTAGTTTCATAC
CCATTGTCCTTGTATAGAGACATTGCTAAGCTGGCAAAAGCATCCGCCTTGGCATTTGTTAGCATGATAGTCATT
GTCGTCACAGTCATCACCCAGGGCTTTCGGGTCCCGCCTGAATCGCGTGGAGAGATCAAAAGCCACCTCGTATTC
AACACTGGCTTTTTTCAGGCTGTCGGGGTCATTTCTTTTGCTTTCGTTTGTCACCACAACAGTCTTCTGATCTAT
GGCTCACTGAAAAAGCCGACACTCGACCGTTTCGCCCGAGTCACACATTACTCGACAGGAATATCTCTGGTGATG
TGTCTAGCAATGGGTATCGCAGGGTTTCTGTCGTTCGGGTCTAAAACCCAGGGCAACGTTCTGAACAACTTCCCA
TCAGACAATATCGTTGTCAATATCGCACGATTCTGCTTTGGCTTGAACATGTTGACCACGCTACCGCTCGAGGCG
TTCGTCTGCCGTTCCGTCATGACAACCTACTATTTCCCCGACGAACCACACAACACGGTTCGGCATATTATCTTC
ACAACGGCGCTGGTGGTGACTTCGATGGTGTTGTCCTTGATAACCTGCGATCTGGGAAGTGTATTTGAGCTCATT
GGCGCGACTAGTGCTGCTGCTCTGGCTTATATATTCCCTCCTCTCTGTTACATCAAGCTTAGCAGTGCTACGCGG
CGAGAGAAGATCCCAGCATACCTATGTATTTGTTTTGGTGTGCTTGTGATGGGTGTCAGTGTAGTGCAGGCGGTC
ATCAAGATCATTCGAAATGATGGCGAGGCCCATAGTTGCAGTGCACGTTAG
Transcript >Pro_DTO377G3_2|g7200.t1
ATGCCAGGGGATGAGTTGTCAGAGGATCACCTGTATGCCCGGAATGGCCAGGATGAACATGAAGCCCAATCCCTC
CTGTCTGCTTCAAGCGAGGAGCATGACCTAGCTCTCCATCCGGAGCCTCTTCCGTCGCCGATCCCCTCACATAAC
GCGACAAGTAGCATATCCCACTCCGCGATTTCTCAACCTGCAACCGACGGAAAGCGCCGTACACCCCGTACCATG
AACCGAGTTCGATTCGACCTGGACGAAGAACCTGAAAACAATCGCATTTCCATTGAGCGTACTCTCAGCCCGGAC
GACAGTCCAGATGACACACTATGGCTGGAGGACGAGGACTATGAACTTGGAAACCGAGGCCCAGGGACACACCAC
AGTGGACAATCAATTCCTCTTCTCACAAATATCGAAGCGCCTAGTGTGACACTTGCAACGTCGGACGATTTCTTC
CCCGAAGATCATCTCGAAAATGCGCGGCCGCGGAGTGGGATGAAAATGGCGTTCATGAACATGGCCAACAGCATT
ATCGGCGCTGGGATTATTGGGCAACCTTACGCGCTCCGTCAAGCAGGCATGGCGATGGGAATTGTGCTGCTGACT
GCCTTGACCGTCACAGTGGACTGGACTATTCGATTGATTGTGGTCAACTCTAAATTGAGTGGGGCGGATTCCTTT
CAGGCAACTATGCAGCATTGCTTCGGGAAGAGTGGTCTCATCGCGATCTCAGTTGCACAGTGGGCATTTGCATTC
GGTGGCATGGTCGCATTTTGCATTATTGTTGGCGATACCATTCCACACGTTCTAGGCGCTTTATTTCCGTCTCTT
AAGGATATGGCCTTCCTCTGGCTTTTCACAGACCGCAGGGCGGTTATCGTTATTTTCGTTTTGGTAGTTTCATAC
CCATTGTCCTTGTATAGAGACATTGCTAAGCTGGCAAAAGCATCCGCCTTGGCATTTGTTAGCATGATAGTCATT
GTCGTCACAGTCATCACCCAGGGCTTTCGGGTCCCGCCTGAATCGCGTGGAGAGATCAAAAGCCACCTCGTATTC
AACACTGGCTTTTTTCAGGCTGTCGGGGTCATTTCTTTTGCTTTCGTTTGTCACCACAACAGTCTTCTGATCTAT
GGCTCACTGAAAAAGCCGACACTCGACCGTTTCGCCCGAGTCACACATTACTCGACAGGAATATCTCTGGTGATG
TGTCTAGCAATGGGTATCGCAGGGTTTCTGTCGTTCGGGTCTAAAACCCAGGGCAACGTTCTGAACAACTTCCCA
TCAGACAATATCGTTGTCAATATCGCACGATTCTGCTTTGGCTTGAACATGTTGACCACGCTACCGCTCGAGGCG
TTCGTCTGCCGTTCCGTCATGACAACCTACTATTTCCCCGACGAACCACACAACACGGTTCGGCATATTATCTTC
ACAACGGCGCTGGTGGTGACTTCGATGGTGTTGTCCTTGATAACCTGCGATCTGGGAAGTGTATTTGAGCTCATT
GGCGCGACTAGTGCTGCTGCTCTGGCTTATATATTCCCTCCTCTCTGTTACATCAAGCTTAGCAGTGCTACGCGG
CGAGAGAAGATCCCAGCATACCTATGTATTTGTTTTGGTGTGCTTGTGATGGGTGTCAGTGTAGTGCAGGCGGTC
ATCAAGATCATTCGAAATGATGGCGAGGCCCATAGTTGCAGTGCACGTTAG
Gene >Pro_DTO377G3_2|g7200.t1
ATGCCAGGGGATGAGTTGTCAGAGGATCACCTGTATGCCCGGAATGGCCAGGATGAACATGAAGCCCAATCCCTC
CTGTCTGCTTCAAGCGAGGAGCATGACCTAGCTCTCCATCCGGAGCCTCTTCCGTCGCCGATCCCCTCACATAAC
GCGACAAGTAGCATATCCCACTCCGCGATTTCTCAACCTGCAACCGACGGAAAGCGCCGTACACCCCGTACCATG
AACCGAGTTCGATTCGACCTGGACGAAGAACCTGAAAACAATCGCATTTCCATTGAGCGTACTCTCAGCCCGGAC
GACAGTCCAGATGACACACTATGGCTGGAGGACGAGGACTATGAACTTGGAAACCGAGGCCCAGGGACACACCAC
AGTGGACAATCAATTCCTCTTCTCACAAATATCGAAGCGCCTAGTGTGACACTTGCAACGTCGGACGATTTCTTC
CCCGAAGATCATCTCGAAAATGCGCGGCCGCGGAGTGGGATGAAAATGGCGTTCATGAACATGGCCAACAGCATT
ATCGGCGCTGGGATTATTGGGCAACCTTACGCGCTCCGTCAAGCAGGCATGGCGATGGGAATTGTGCTGCTGACT
GCCTTGACCGTCACAGTGGACTGGACTATTCGATTGATTGTGGTCAACTCTAAATTGAGTGGGGCGGATTCCTTT
CAGGCAACTATGCAGCATTGCTTCGGGAAGAGTGGTCTCATCGCGATCTCAGTTGCACAGTGGGCATTTGCATTC
GGTGGCATGGTCGCATTTTGCATTATTGTTGGCGATACCATTCCACACGTTCTAGGCGCTTTATTTCCGTCTCTT
AAGGATATGGCCTTCCTCTGGCTTTTCACAGACCGCAGGGCGGTTATCGTTATTTTCGTTTTGGTAGTTTCATAC
CCATTGTCCTTGTATAGAGACATTGCTAAGGTCAGCTCGTTCCTTCCTTACTATTTATCATAGACTAACAGTCAG
ATAGCTGGCAAAAGCATCCGCCTTGGCATTTGTTAGCATGATAGTCATTGTCGTCACAGTCATCACCCAGGGCTT
TCGGGTCCCGCCTGAATCGCGTGGAGAGATCAAAAGCCACCTCGTATTCAACACTGGCTTTTTTCAGGCTGTCGG
GGTCATTTCTTTTGGTAAGTTTTAGCTGCCCTGTCAATACTTGGAAAGCTTCTAACAATTTCCAGCTTTCGTTTG
TCGTATGTTCCTTTTTATCCTACTGATATCCCAACCACTAATTTCCACAGACCACAACAGTCTTCTGATCTATGG
CTCACTGAAAAAGCCGACACTCGACCGTTTCGCCCGAGTCACACATTACTCGACAGGAATATCTCTGGTGATGTG
TCTAGCAATGGGTATCGCAGGGTTTCTGTCGTTCGGGTCTAAAACCCAGGGCAACGTTCTGAACAACTTCCCATC
AGACAATATCGTTGTCAATATCGCACGATTGTACAATCTTCCCATTGATATTGATATAGAGATTCTTGACTGACT
TCTATTAGCTGCTTTGGCTTGAACATGTTGACCACGCTACCGCTCGAGGCGTTCGTCTGCCGTTCCGTCATGACA
ACCTACTATTTCCCCGACGAACCACACAACACGGTTCGGCATATTATCTTCACAACGGCGCTGGTGGTGACTTCG
ATGGTGTTGTCCTTGATAACCTGCGATCTGGGAAGTGTATTTGAGCTCATTGGCGCGACTAGTGCTGCTGCTCTG
GCTTATATATTCCCTCCTCTCTGTTACATCAAGCTTAGCAGTGCTACGCGGCGAGAGAAGATCCCAGCATACCTA
TGTATTTGTTTTGGTGTGCTTGTGATGGGTGTCAGTGTAGTGCAGGCGGTCATCAAGATCATTCGAAGTAAGTGT
GTCCCGGAAGATGGTTGCAATTGGACCCAGTTGATAGCTATTTGGTCGCATCCTCCGCAAATATACTAACATTGA
AATTTGCAGATGATGGCGAGGCCCATAGTTGCAGTGCACGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail