Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7178.t1
Gene name
Locationscaffold_21:261289..261618
Strand+
Gene length (bp)329
Transcript length (bp)207
Coding sequence length (bp)207
Protein length (aa) 69

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02935 COX7C Cytochrome c oxidase subunit VIIc 7.7E-23 3 66

GO

GO Term Description Terminal node
GO:0005751 mitochondrial respiratory chain complex IV Yes
GO:0006123 mitochondrial electron transport, cytochrome c to oxygen Yes
GO:0098803 respiratory chain complex No
GO:0015980 energy derivation by oxidation of organic compounds No
GO:0045277 respiratory chain complex IV No
GO:0098798 mitochondrial protein-containing complex No
GO:0008150 biological_process No
GO:0005575 cellular_component No
GO:0045333 cellular respiration No
GO:0009060 aerobic respiration No
GO:0008152 metabolic process No
GO:0032991 protein-containing complex No
GO:0070069 cytochrome complex No
GO:0006091 generation of precursor metabolites and energy No
GO:0019646 aerobic electron transport chain No
GO:0022904 respiratory electron transport chain No
GO:0022900 electron transport chain No
GO:0098796 membrane protein complex No
GO:0098800 inner mitochondrial membrane protein complex No
GO:0044237 cellular metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 40 62 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7178.t1
MATSFAARRGFSTTRTQLASPYHYAEGPRSNIPFNPLTKYFFLRYWSFMIAGFGAPFAIAVWQTYKTK*
Coding >Pro_DTO377G3_2|g7178.t1
ATGGCCACCTCCTTCGCTGCCCGTCGTGGCTTCTCCACCACTCGCACCCAGCTTGCTAGCCCCTACCACTACGCC
GAGGGTCCTCGCTCCAACATCCCCTTCAACCCGCTCACCAAGTACTTCTTCTTGCGCTACTGGAGCTTCATGATT
GCCGGATTCGGTGCTCCCTTCGCCATTGCCGTCTGGCAAACCTACAAGACCAAATAA
Transcript >Pro_DTO377G3_2|g7178.t1
ATGGCCACCTCCTTCGCTGCCCGTCGTGGCTTCTCCACCACTCGCACCCAGCTTGCTAGCCCCTACCACTACGCC
GAGGGTCCTCGCTCCAACATCCCCTTCAACCCGCTCACCAAGTACTTCTTCTTGCGCTACTGGAGCTTCATGATT
GCCGGATTCGGTGCTCCCTTCGCCATTGCCGTCTGGCAAACCTACAAGACCAAATAA
Gene >Pro_DTO377G3_2|g7178.t1
ATGGCCACCTCCTTCGCTGCCCGTCGTGGCTTCTCCACCACTCGCACCCAGCTTGCTAGCCCCTACCACTACGCC
GAGGGTCCTCGCTCCAACATCCCCTTCAACCCGCTCACCAAGTACTTCTTCTTGCGCTACTGGAGCTTCATGAGT
TAGTGGTCCCCAACTTACATATGCGCAGTGCCATGACTAACTCGGACATCATCTAGTTGCCGGATTCGGTGCTCC
CTTCGCCATTGCCGGTGAGCTATACCCCCTCTCTACGATTCTAAGCCTTAAGCATACTCTAACATCTCTTTCTAC
TAGTCTGGCAAACCTACAAGACCAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail