Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7176.t1
Gene name
Locationscaffold_21:256098..257129
Strand-
Gene length (bp)1031
Transcript length (bp)936
Coding sequence length (bp)936
Protein length (aa) 312

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08559 Cut8 Cut8, nuclear proteasome tether protein 5.2E-80 35 268

GO

GO Term Description Terminal node
GO:0071630 nuclear protein quality control by the ubiquitin-proteasome system Yes
GO:0005634 nucleus Yes
GO:0031144 proteasome localization Yes
GO:0044464 cell part No
GO:0044238 primary metabolic process No
GO:0009056 catabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0006508 proteolysis No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0031503 protein-containing complex localization No
GO:0043170 macromolecule metabolic process No
GO:0044248 cellular catabolic process No
GO:0008104 protein localization No
GO:0070727 cellular macromolecule localization No
GO:0051641 cellular localization No
GO:0051603 proteolysis involved in cellular protein catabolic process No
GO:0043227 membrane-bounded organelle No
GO:0051179 localization No
GO:1901564 organonitrogen compound metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0044237 cellular metabolic process No
GO:0034613 cellular protein localization No
GO:0019538 protein metabolic process No
GO:0044424 intracellular part No
GO:0030163 protein catabolic process No
GO:0006515 protein quality control for misfolded or incompletely synthesized proteins No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0010498 proteasomal protein catabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:0043229 intracellular organelle No
GO:1901565 organonitrogen compound catabolic process No
GO:0034629 cellular protein-containing complex localization No
GO:0033036 macromolecule localization No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0043226 organelle No
GO:0019941 modification-dependent protein catabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7176.t1
MNSLVATPPVPPHFYENSRFSPSRMMSTPSSSYASRKRKADDDNDHDGRMSASPTNSPAATPRQLPHSYRNIKRS
RPNVSGRPLSLPRLLETLDTDALRTVVRTMCERHPQLVDEVVHTSPRPNVSSTLQVLRNYQAALQSSFPLGGNTE
SDYAYNRVRQPLTNLLDALSDFTPNFLPPNESQASTSLSYLDGATDIIHALPRWSTPQNNIERDSAYDEMCKAWI
LVIREAAKRGGGIQLQYGGWDQKLAKHNQTSGGKLQGAVNELGLSLGWMNGPDTPSHGTNGDMGSIRDQLFSGTY
GLGTPVKVGPW*
Coding >Pro_DTO377G3_2|g7176.t1
ATGAACAGCTTGGTGGCCACACCTCCTGTTCCTCCTCACTTCTACGAGAACTCCCGATTCTCTCCTTCCCGTATG
ATGTCTACACCCTCTTCGTCGTATGCCAGTCGTAAACGGAAAGCCGACGACGACAATGATCATGATGGACGCATG
TCTGCTTCGCCTACAAACTCTCCCGCCGCCACTCCTCGACAACTACCTCACAGCTACCGTAACATCAAACGTTCC
CGACCGAACGTTTCAGGCCGACCTCTATCTCTGCCCCGTCTGCTAGAGACCCTCGATACAGATGCCTTGCGGACT
GTTGTACGGACCATGTGCGAGCGTCACCCTCAACTCGTCGATGAGGTTGTGCACACATCCCCACGTCCGAATGTA
TCCTCAACTCTCCAAGTCCTTCGGAACTATCAGGCCGCCCTCCAGTCGTCATTCCCGTTGGGTGGCAACACCGAA
TCGGACTACGCATACAATCGAGTCCGACAGCCGCTCACCAACCTTCTTGACGCCTTGAGTGACTTCACACCTAAC
TTCCTTCCCCCAAACGAATCACAAGCATCCACATCCCTGAGCTACCTAGATGGGGCAACTGACATCATTCATGCC
TTGCCTCGCTGGAGCACGCCACAGAACAACATTGAACGAGACTCAGCTTATGACGAGATGTGCAAGGCATGGATT
TTGGTCATCCGGGAAGCGGCAAAAAGAGGTGGTGGCATCCAATTGCAATATGGAGGTTGGGATCAAAAGTTGGCC
AAGCACAACCAAACCTCTGGAGGAAAGCTACAGGGAGCTGTCAACGAACTCGGTCTCAGCTTGGGATGGATGAAT
GGACCTGACACACCATCCCACGGAACCAACGGCGATATGGGCTCTATACGGGATCAGCTCTTTTCCGGTACTTAC
GGGCTGGGAACACCAGTCAAGGTCGGACCTTGGTGA
Transcript >Pro_DTO377G3_2|g7176.t1
ATGAACAGCTTGGTGGCCACACCTCCTGTTCCTCCTCACTTCTACGAGAACTCCCGATTCTCTCCTTCCCGTATG
ATGTCTACACCCTCTTCGTCGTATGCCAGTCGTAAACGGAAAGCCGACGACGACAATGATCATGATGGACGCATG
TCTGCTTCGCCTACAAACTCTCCCGCCGCCACTCCTCGACAACTACCTCACAGCTACCGTAACATCAAACGTTCC
CGACCGAACGTTTCAGGCCGACCTCTATCTCTGCCCCGTCTGCTAGAGACCCTCGATACAGATGCCTTGCGGACT
GTTGTACGGACCATGTGCGAGCGTCACCCTCAACTCGTCGATGAGGTTGTGCACACATCCCCACGTCCGAATGTA
TCCTCAACTCTCCAAGTCCTTCGGAACTATCAGGCCGCCCTCCAGTCGTCATTCCCGTTGGGTGGCAACACCGAA
TCGGACTACGCATACAATCGAGTCCGACAGCCGCTCACCAACCTTCTTGACGCCTTGAGTGACTTCACACCTAAC
TTCCTTCCCCCAAACGAATCACAAGCATCCACATCCCTGAGCTACCTAGATGGGGCAACTGACATCATTCATGCC
TTGCCTCGCTGGAGCACGCCACAGAACAACATTGAACGAGACTCAGCTTATGACGAGATGTGCAAGGCATGGATT
TTGGTCATCCGGGAAGCGGCAAAAAGAGGTGGTGGCATCCAATTGCAATATGGAGGTTGGGATCAAAAGTTGGCC
AAGCACAACCAAACCTCTGGAGGAAAGCTACAGGGAGCTGTCAACGAACTCGGTCTCAGCTTGGGATGGATGAAT
GGACCTGACACACCATCCCACGGAACCAACGGCGATATGGGCTCTATACGGGATCAGCTCTTTTCCGGTACTTAC
GGGCTGGGAACACCAGTCAAGGTCGGACCTTGGTGA
Gene >Pro_DTO377G3_2|g7176.t1
ATGAACAGCTTGGTGGCCACACCTCCTGTTCCTCCTCACTTCTACGAGAACTCCCGATTCTCTCCTTCCCGTATG
AGTAAGATATCCCTTCCCCTTGGAATGATTTGTTTTCTCTGTCCGGTTTAGAGGTGGTTCTTCTTTGATGCATTC
GTGTACTGACAGAACGGCCAGTGTCTACACCCTCTTCGTCGTATGCCAGTCGTAAACGGAAAGCCGACGACGACA
ATGATCATGATGGACGCATGTCTGCTTCGCCTACAAACTCTCCCGCCGCCACTCCTCGACAACTACCTCACAGCT
ACCGTAACATCAAACGTTCCCGACCGAACGTTTCAGGCCGACCTCTATCTCTGCCCCGTCTGCTAGAGACCCTCG
ATACAGATGCCTTGCGGACTGTTGTACGGACCATGTGCGAGCGTCACCCTCAACTCGTCGATGAGGTTGTGCACA
CATCCCCACGTCCGAATGTATCCTCAACTCTCCAAGTCCTTCGGAACTATCAGGCCGCCCTCCAGTCGTCATTCC
CGTTGGGTGGCAACACCGAATCGGACTACGCATACAATCGAGTCCGACAGCCGCTCACCAACCTTCTTGACGCCT
TGAGTGACTTCACACCTAACTTCCTTCCCCCAAACGAATCACAAGCATCCACATCCCTGAGCTACCTAGATGGGG
CAACTGACATCATTCATGCCTTGCCTCGCTGGAGCACGCCACAGAACAACATTGAACGAGACTCAGCTTATGACG
AGATGTGCAAGGCATGGATTTTGGTCATCCGGGAAGCGGCAAAAAGAGGTGGTGGCATCCAATTGCAATATGGAG
GTTGGGATCAAAAGTTGGCCAAGCACAACCAAACCTCTGGAGGAAAGCTACAGGGAGCTGTCAACGAACTCGGTC
TCAGCTTGGGATGGATGAATGGACCTGACACACCATCCCACGGAACCAACGGCGATATGGGCTCTATACGGGATC
AGCTCTTTTCCGGTACTTACGGGCTGGGAACACCAGTCAAGGTCGGACCTTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail