Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7173.t1
Gene name
Locationscaffold_21:249969..251112
Strand+
Gene length (bp)1143
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02729 OTCace_N Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding domain 1.3E-45 54 198
PF00185 OTCace Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain 2.7E-45 213 368

GO

GO Term Description Terminal node
GO:0016743 carboxyl- or carbamoyltransferase activity Yes
GO:0016597 amino acid binding Yes
GO:0006520 cellular amino acid metabolic process Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0036094 small molecule binding No
GO:0019752 carboxylic acid metabolic process No
GO:0016740 transferase activity No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043177 organic acid binding No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0008152 metabolic process No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0031406 carboxylic acid binding No
GO:0044237 cellular metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7173.t1
MASGLTAAARYGAQSVNQLAGSTSSLRRTLQANGIRRFAHQTPTLPPTSPFAPRHLLSIADLTPTEFATLVRNAA
SHKRAIKSGAIPESLLGSLSGKTVAMMFNKRSTRTRVSTEAAAVQMGGHPMFLGKDDIQLGVNESLYDTSVVISS
MVSCIVARVAKHEDVAGLAQHSTVPVINALCDSFHPLQIIADFLTIHENFPAHAHKLSGLGLEGLKIAWVGDANN
VLFDLAIGATKMGVDVAVATPKGYEIPAHMIDIIQRAGEGVDKAGKLTQTNVPEEAVKNADILVTDTWVSMGQEE
ESKKRMRAFEGFQITADLAKRGGAKEGWKFMHCLPRHPEEVDDEVFYGPRSLVFPEAENRLWAAIAALEGFVVNK
GKIVE*
Coding >Pro_DTO377G3_2|g7173.t1
ATGGCTAGTGGTCTCACAGCTGCCGCCCGTTATGGTGCCCAAAGTGTAAACCAATTGGCCGGCTCCACCTCATCT
TTGCGTCGAACACTCCAGGCTAATGGAATCCGACGATTTGCCCACCAGACACCGACTTTACCTCCCACCTCTCCT
TTCGCCCCTCGTCATCTTCTCTCCATTGCAGACCTGACCCCTACGGAATTCGCGACCCTGGTCCGCAATGCTGCG
TCGCACAAGCGTGCTATCAAGTCCGGGGCCATTCCCGAAAGCCTATTGGGATCTCTCTCCGGCAAGACCGTGGCC
ATGATGTTCAACAAGCGCAGTACTCGCACTCGTGTATCCACCGAAGCCGCCGCCGTCCAGATGGGTGGCCACCCC
ATGTTCCTCGGAAAGGATGACATCCAGCTTGGTGTCAACGAGTCGCTATACGATACCTCCGTTGTGATTTCCTCC
ATGGTCTCGTGCATTGTCGCACGTGTCGCCAAGCACGAGGACGTCGCAGGTCTGGCACAACACTCCACCGTACCT
GTGATTAATGCACTTTGCGACTCCTTCCACCCTCTCCAGATCATCGCCGACTTCTTGACCATCCACGAGAACTTC
CCGGCCCACGCGCACAAGCTCTCCGGCCTGGGCCTGGAGGGTCTTAAGATCGCTTGGGTTGGTGATGCGAACAAC
GTTCTGTTCGATCTGGCCATTGGTGCTACTAAGATGGGTGTGGACGTGGCTGTTGCTACTCCTAAGGGCTACGAG
ATCCCTGCGCATATGATTGACATCATCCAACGCGCTGGTGAGGGAGTTGACAAGGCTGGCAAGCTCACCCAGACC
AATGTCCCCGAGGAAGCCGTCAAGAACGCCGACATCCTGGTTACGGATACCTGGGTCTCCATGGGCCAGGAGGAG
GAGTCTAAGAAGCGCATGAGGGCCTTTGAGGGCTTCCAGATCACTGCTGATTTGGCTAAGCGCGGTGGCGCTAAG
GAGGGCTGGAAGTTCATGCACTGCCTACCCCGTCACCCCGAGGAAGTGGATGATGAGGTCTTCTACGGCCCGCGC
TCTCTGGTCTTCCCTGAAGCCGAAAATCGGCTGTGGGCGGCTATTGCCGCCTTGGAAGGCTTTGTTGTAAACAAG
GGAAAAATTGTGGAGTAA
Transcript >Pro_DTO377G3_2|g7173.t1
ATGGCTAGTGGTCTCACAGCTGCCGCCCGTTATGGTGCCCAAAGTGTAAACCAATTGGCCGGCTCCACCTCATCT
TTGCGTCGAACACTCCAGGCTAATGGAATCCGACGATTTGCCCACCAGACACCGACTTTACCTCCCACCTCTCCT
TTCGCCCCTCGTCATCTTCTCTCCATTGCAGACCTGACCCCTACGGAATTCGCGACCCTGGTCCGCAATGCTGCG
TCGCACAAGCGTGCTATCAAGTCCGGGGCCATTCCCGAAAGCCTATTGGGATCTCTCTCCGGCAAGACCGTGGCC
ATGATGTTCAACAAGCGCAGTACTCGCACTCGTGTATCCACCGAAGCCGCCGCCGTCCAGATGGGTGGCCACCCC
ATGTTCCTCGGAAAGGATGACATCCAGCTTGGTGTCAACGAGTCGCTATACGATACCTCCGTTGTGATTTCCTCC
ATGGTCTCGTGCATTGTCGCACGTGTCGCCAAGCACGAGGACGTCGCAGGTCTGGCACAACACTCCACCGTACCT
GTGATTAATGCACTTTGCGACTCCTTCCACCCTCTCCAGATCATCGCCGACTTCTTGACCATCCACGAGAACTTC
CCGGCCCACGCGCACAAGCTCTCCGGCCTGGGCCTGGAGGGTCTTAAGATCGCTTGGGTTGGTGATGCGAACAAC
GTTCTGTTCGATCTGGCCATTGGTGCTACTAAGATGGGTGTGGACGTGGCTGTTGCTACTCCTAAGGGCTACGAG
ATCCCTGCGCATATGATTGACATCATCCAACGCGCTGGTGAGGGAGTTGACAAGGCTGGCAAGCTCACCCAGACC
AATGTCCCCGAGGAAGCCGTCAAGAACGCCGACATCCTGGTTACGGATACCTGGGTCTCCATGGGCCAGGAGGAG
GAGTCTAAGAAGCGCATGAGGGCCTTTGAGGGCTTCCAGATCACTGCTGATTTGGCTAAGCGCGGTGGCGCTAAG
GAGGGCTGGAAGTTCATGCACTGCCTACCCCGTCACCCCGAGGAAGTGGATGATGAGGTCTTCTACGGCCCGCGC
TCTCTGGTCTTCCCTGAAGCCGAAAATCGGCTGTGGGCGGCTATTGCCGCCTTGGAAGGCTTTGTTGTAAACAAG
GGAAAAATTGTGGAGTAA
Gene >Pro_DTO377G3_2|g7173.t1
ATGGCTAGTGGTCTCACAGCTGCCGCCCGTTATGGTGCCCAAAGTGTAAACCAATTGGCCGGCTCCACCTCATCT
TTGCGTCGAACACTCCAGGCTAATGGAATCCGACGATTTGCCCACCAGACACCGACTTTACCTCCCACCTCTCCT
TTCGCCCCTCGTCATCTTCTCTCCATTGCAGACCTGACCCCTACGGAATTCGCGACCCTGGTCCGCAATGCTGCG
TCGCACAAGCGTGCTATCAAGTCCGGGGCCATTCCCGAAAGCCTATTGGGATCTCTCTCCGGCAAGACCGTGGCC
ATGATGTTCAACAAGCGCAGTACTCGCACTCGTGTATCCACCGAAGCCGCCGCCGTCCAGATGGGTGGCCACCCC
ATGTTCCTCGGAAAGGATGACATCCAGCTTGGTGTCAACGAGTCGCTATACGATACCTCCGTTGTGATTTCCTCC
ATGGTCTCGTGCATTGTCGCACGTGTCGCCAAGCACGAGGACGTCGCAGGTCTGGCACAACACTCCACCGTACCT
GTGATTAATGCACTTTGCGACTCCTTCCACCCTCTCCAGATCATCGCCGACTTCTTGACCATCCACGAGAACTTC
CCGGCCCACGCGCACAAGCTCTCCGGCCTGGGCCTGGAGGGTCTTAAGATCGCTTGGGTTGGTGATGCGAACAAC
GTTCTGTTCGATCTGGCCATTGGTGCTACTAAGATGGGTGTGGACGTGGCTGTTGCTACTCCTAAGGGCTACGAG
ATCCCTGCGCATATGATTGACATCATCCAACGCGCTGGTGAGGGAGTTGACAAGGCTGGCAAGCTCACCCAGACC
AATGTCCCCGAGGAAGCCGTCAAGAACGCCGACATCCTGGTTACGGATACCTGGGTCTCCATGGGCCAGGAGGAG
GAGTCTAAGAAGCGCATGAGGGCCTTTGAGGGCTTCCAGATCACTGCTGATTTGGCTAAGCGCGGTGGCGCTAAG
GAGGGCTGGAAGTTCATGCACTGCCTACCCCGTCACCCCGAGGAAGTGGATGATGAGGTCTTCTACGGCCCGCGC
TCTCTGGTCTTCCCTGAAGCCGAAAATCGGCTGTGGGCGGCTATTGCCGCCTTGGAAGGCTTTGTTGTAAACAAG
GGAAAAATTGTGGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail