Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7157.t1
Gene name
Locationscaffold_21:212906..214076
Strand-
Gene length (bp)1170
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09320 DUF1977 Domain of unknown function (DUF1977) 3.6E-32 237 342
PF00226 DnaJ DnaJ domain 3.9E-22 49 109

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 76.48 45.67 107.30
5d_25C Five days - 25 degrees Celsius 92.53 56.01 129.06
7d_25C Seven days - 25 degrees Celsius 99.16 60.13 138.20
10d_25C Ten days - 25 degrees Celsius 133.24 80.97 185.52
7d_15C Seven days - 15 degrees Celsius 82.56 49.24 115.87
7d_30C Seven days - 30 degrees Celsius 97.24 58.79 135.69

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.462329 no
3d_25C 7d_25C 0.268414 no
3d_25C 7d_15C 0.809572 no
3d_25C 7d_30C 0.320184 no
3d_25C 10d_25C 0.005235 yes
5d_25C 7d_25C 0.822218 no
5d_25C 7d_15C 0.688245 no
5d_25C 7d_30C 0.878727 no
5d_25C 10d_25C 0.095402 no
7d_25C 7d_15C 0.473774 no
7d_25C 7d_30C 0.955520 no
7d_25C 10d_25C 0.197987 no
7d_15C 7d_30C 0.530254 no
7d_15C 10d_25C 0.019090 yes
7d_30C 10d_25C 0.167774 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7157.t1
MPSASASGSDAKRGGATSRDHKQGNQDRKYTEEQKAAVLRIRRCQPTAFYEILLVERSSTDNEIKKAYRKQSLLT
HPDKNGHEGADEAFKMVSRAFQILSDEEKKSKYDKFGGDPDSRFQPGPSASSGASPFGGFGGGFGRDQRFNEEVS
AEEMFNRFFNGGFGGMGGGGFGGPQFVFNMGGGPGFRVHQFGGQAPRRRPRAAATEQEAQIDSRSFLRQLLPLII
LFILPLLSSLFSGSSTPSGPSYRFDTPVSPHTLGRVTPKLNLNYFVNPLDVDSYSARNFRELDSRVEVEYVRTLR
NECDAEAHERERRLQDAQGWLFPDVEKMKKARAMEMPSCRRLDQLKTKVRY*
Coding >Pro_DTO377G3_2|g7157.t1
ATGCCCTCGGCTTCGGCATCTGGCTCTGACGCCAAACGCGGAGGTGCGACGTCGCGCGACCATAAGCAAGGTAAC
CAGGATCGCAAGTATACAGAAGAGCAGAAAGCTGCTGTGCTTCGGATTCGAAGATGCCAGCCTACGGCCTTTTAC
GAAATTCTGCTGGTCGAGCGCTCGTCAACGGATAATGAGATTAAGAAGGCGTACCGGAAACAGAGTTTGTTGACG
CATCCTGATAAAAACGGGCACGAGGGCGCAGACGAGGCGTTTAAGATGGTCTCGCGTGCTTTCCAGATTCTCTCC
GACGAGGAAAAGAAGTCGAAATACGACAAATTCGGCGGCGATCCTGATAGCAGGTTCCAACCCGGACCGAGCGCT
TCGAGCGGCGCGTCGCCCTTCGGTGGATTCGGTGGTGGATTCGGCCGTGACCAAAGATTCAACGAGGAAGTCTCA
GCCGAGGAAATGTTCAACCGGTTCTTTAATGGTGGATTTGGCGGAATGGGCGGTGGTGGATTCGGCGGTCCGCAA
TTCGTCTTCAACATGGGAGGAGGCCCCGGGTTCCGAGTGCATCAGTTTGGAGGCCAGGCGCCCCGTCGCCGGCCT
CGCGCAGCAGCCACCGAGCAGGAAGCTCAGATCGATAGCCGCAGTTTCCTGCGCCAGCTATTGCCGCTTATCATT
CTATTTATCCTGCCGCTCCTCTCCTCTCTCTTCTCTGGCTCCTCAACCCCATCCGGACCCTCCTATCGCTTTGAT
ACCCCCGTCTCCCCGCATACCCTCGGCCGCGTGACCCCGAAACTCAACCTCAACTACTTTGTGAACCCTCTCGAT
GTGGATAGCTATAGTGCCCGGAACTTTCGCGAGCTAGACTCGCGCGTGGAGGTGGAATATGTCAGGACACTGCGG
AATGAATGTGACGCCGAAGCCCATGAGCGGGAGAGGAGGCTGCAAGATGCGCAGGGGTGGCTCTTCCCTGACGTT
GAGAAAATGAAGAAGGCTCGTGCGATGGAGATGCCGAGCTGCAGGCGTCTGGACCAACTGAAGACGAAGGTGAGA
TATTAA
Transcript >Pro_DTO377G3_2|g7157.t1
ATGCCCTCGGCTTCGGCATCTGGCTCTGACGCCAAACGCGGAGGTGCGACGTCGCGCGACCATAAGCAAGGTAAC
CAGGATCGCAAGTATACAGAAGAGCAGAAAGCTGCTGTGCTTCGGATTCGAAGATGCCAGCCTACGGCCTTTTAC
GAAATTCTGCTGGTCGAGCGCTCGTCAACGGATAATGAGATTAAGAAGGCGTACCGGAAACAGAGTTTGTTGACG
CATCCTGATAAAAACGGGCACGAGGGCGCAGACGAGGCGTTTAAGATGGTCTCGCGTGCTTTCCAGATTCTCTCC
GACGAGGAAAAGAAGTCGAAATACGACAAATTCGGCGGCGATCCTGATAGCAGGTTCCAACCCGGACCGAGCGCT
TCGAGCGGCGCGTCGCCCTTCGGTGGATTCGGTGGTGGATTCGGCCGTGACCAAAGATTCAACGAGGAAGTCTCA
GCCGAGGAAATGTTCAACCGGTTCTTTAATGGTGGATTTGGCGGAATGGGCGGTGGTGGATTCGGCGGTCCGCAA
TTCGTCTTCAACATGGGAGGAGGCCCCGGGTTCCGAGTGCATCAGTTTGGAGGCCAGGCGCCCCGTCGCCGGCCT
CGCGCAGCAGCCACCGAGCAGGAAGCTCAGATCGATAGCCGCAGTTTCCTGCGCCAGCTATTGCCGCTTATCATT
CTATTTATCCTGCCGCTCCTCTCCTCTCTCTTCTCTGGCTCCTCAACCCCATCCGGACCCTCCTATCGCTTTGAT
ACCCCCGTCTCCCCGCATACCCTCGGCCGCGTGACCCCGAAACTCAACCTCAACTACTTTGTGAACCCTCTCGAT
GTGGATAGCTATAGTGCCCGGAACTTTCGCGAGCTAGACTCGCGCGTGGAGGTGGAATATGTCAGGACACTGCGG
AATGAATGTGACGCCGAAGCCCATGAGCGGGAGAGGAGGCTGCAAGATGCGCAGGGGTGGCTCTTCCCTGACGTT
GAGAAAATGAAGAAGGCTCGTGCGATGGAGATGCCGAGCTGCAGGCGTCTGGACCAACTGAAGACGAAGGTGAGA
TATTAA
Gene >Pro_DTO377G3_2|g7157.t1
ATGCCCTCGGCTTCGGCATCTGGCTCTGACGCCAAACGCGGAGGTGCGACGTCGCGCGACCATAAGCAAGGTAAC
CAGGATCGCAAGTATACAGAAGAGCAGAAAGCTGCTGTGCTTCGGATTCGAAGATGCCAGCCTACGGCCTTTTAC
GAAATTCTGCTGGTCGAGCGCTCGTCAACGGATAATGAGATTAAGAAGGCGTACCGGAAACAGAGTTTGTTGACG
CATCCTGATAAAAACGGGCACGAGGGCGCAGACGAGGCGTTTAAGAGTGAGCAATGAGCACCCCTAGCCAAACTC
TTGACATATTGATTCTTACGCGGTGACAGTGGTCTCGCGTGCTTTCCAGATTCTCTCCGACGAGGAAAAGAAGTC
GAAATACGACAAATTCGGCGGCGATCCTGATAGCAGGTTCCAACCCGGACCGAGCGCTTCGAGCGGCGCGTCGCC
CTTCGGTGGATTCGGTGGTGGATTCGGCCGTGACCAAAGATTCAACGAGGAAGTCTCAGCCGAGGAAATGTTCAA
CCGGTTCTTTAATGGTGGATTTGGCGGAATGGGCGGTGGTGGATTCGGTACTACAGCTTCCTCTGATATTCGTTT
TACTCGAGCTAATCCTGTCTTACTATAGGCGGTCCGCAATTCGTCTTCAACATGGGAGGAGGCCCCGGGTTCCGA
GTGCATCAGTTTGGAGGCCAGGCGCCCCGTCGCCGGCCTCGCGCAGCAGCCACCGAGCAGGAAGCTCAGATCGAT
AGCCGCAGTTTCCTGCGCCAGCTATTGCCGCTTATCATTCTATTTATCCTGCCGCTCCTCTCCTCTCTCTTCTCT
GGCTCCTCAACCCCATCCGGACCCTCCTATCGCTTTGATACCCCCGTCTCCCCGCATACCCTCGGCCGCGTGACC
CCGAAACTCAACCTCAACTACTTTGTGAACCCTCTCGATGTGGATAGCTATAGTGCCCGGAACTTTCGCGAGCTA
GACTCGCGCGTGGAGGTGGAATATGTCAGGACACTGCGGAATGAATGTGACGCCGAAGCCCATGAGCGGGAGAGG
AGGCTGCAAGATGCGCAGGGGTGGCTCTTCCCTGACGTTGAGAAAATGAAGAAGGCTCGTGCGATGGAGATGCCG
AGCTGCAGGCGTCTGGACCAACTGAAGACGAAGGTGAGATATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail