Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7156.t1
Gene name
Locationscaffold_21:208624..212091
Strand-
Gene length (bp)3467
Transcript length (bp)3165
Coding sequence length (bp)3165
Protein length (aa) 1055

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10408 Ufd2P_core Ubiquitin elongating factor core 8.2E-218 327 951
PF04564 U-box U-box domain 1.9E-25 967 1037

GO

GO Term Description Terminal node
GO:0004842 ubiquitin-protein transferase activity Yes
GO:0034450 ubiquitin-ubiquitin ligase activity Yes
GO:0006511 ubiquitin-dependent protein catabolic process Yes
GO:0016567 protein ubiquitination Yes
GO:0000151 ubiquitin ligase complex Yes
GO:1990234 transferase complex No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0036211 protein modification process No
GO:0044260 cellular macromolecule metabolic process No
GO:0009057 macromolecule catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0006508 proteolysis No
GO:0071704 organic substance metabolic process No
GO:1901575 organic substance catabolic process No
GO:0044464 cell part No
GO:0016740 transferase activity No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0044248 cellular catabolic process No
GO:0061659 ubiquitin-like protein ligase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0051603 proteolysis involved in cellular protein catabolic process No
GO:0006464 cellular protein modification process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032446 protein modification by small protein conjugation No
GO:0044237 cellular metabolic process No
GO:0019538 protein metabolic process No
GO:0044424 intracellular part No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0043412 macromolecule modification No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0061630 ubiquitin protein ligase activity No
GO:0044267 cellular protein metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0008152 metabolic process No
GO:0005575 cellular_component No
GO:0032991 protein-containing complex No
GO:0019941 modification-dependent protein catabolic process No
GO:0009987 cellular process No
GO:0043170 macromolecule metabolic process No
GO:1902494 catalytic complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7156.t1
MSDTLSDADKIRNKRLAKLSNPGQSSDGASESTQSSSNTSPSQSPLSVQPPSRLFNAPPTPQQSEGKRIKITPAA
ASSEQPRTAAPSAPSTPPPQKIESIEAFEDRTLSAVFRVTLKEEGHRDIHGSRTYLPGLRSELQDEGQDLRIQVE
VLDQALLEAASKAEKQRPLDYLLPCWKRITKLYKGLRRTGDDDPKYQVLCEARRLCMSYCIFAITMPEMFGSEWS
PQSSLASYLLIDPEDDRGIDFEFINEAVRRFDEDDSVKPAFISAVEQLSAQLSSMDVNDDYKPYAIALRNLVRHG
SIAAAITESSIFNNTRDPAQFEKATLLGPWFRLSPLQANVTLSYFSSPKTRDQAYISNAQRSLRMTQQMLSSDLL
DVINHLIRASKEARDRVLDWFATAMNINHKRRAMQVDPAQVSSDGFMFNITTCLDQLCEPFMDAAFTKIDRVDAD
YLHRDSRVDMRDETKINADQHASDAFYSKKVEGTSNFITEVFFLTVAAHHYGSESLTSKMEQLEKDVRQMESTIT
KFELERVRWLNNPQQLRTFDTALKKYKDKLELGIALKYSLQGVLFDEQWQARSMLFMRYVTVWLLRLVSGKNFPK
EQVTLPLPEEQPEVFKCLPEYFLEDVVSNFKFIMWCMPQIITATQGDELVMLCITFLECSTYIKNPYLKAGLISI
LFRGTWKRPGGASGVLVDLLNSMPFANEHLLHAVMKFYIEAEFTGTHSQFYDKFNIRYEIFQIIKCIWPNTLYRE
KLSLQANQNLDFFVQFVNLLLNDVTYVLDESFGAFKTIHNTQTELNTQGNSMDAATRQQREENLSSAQRSAKSYM
QLTNQTVAMLKLFTEALADSFTMPEIVQRLADMLDYNLDAMVGPKSSNLRVDNLQEYGFNPRALLSEIVDVYLNL
IGKENFILAVARDGRSYKPANFEKAADIIRKWSLKSPEQLHHWSELQKKVQAAKEADDQAEEDMGEIPEEFLDPL
MYSLMDDPVILPSSRIAIDRATIRSHLLSDPHDPFNRVPLKIEDVVADTELKAKIEAFKNEKLAGKRREMVHDRM
DTSN*
Coding >Pro_DTO377G3_2|g7156.t1
ATGTCGGACACACTTTCCGACGCAGACAAGATTCGCAACAAGCGACTTGCAAAGCTCTCAAACCCAGGCCAGTCC
TCCGACGGTGCCTCCGAATCGACACAGAGCTCATCTAACACATCTCCGTCACAATCACCACTGTCGGTGCAGCCA
CCGAGTCGCCTTTTCAACGCGCCACCAACCCCGCAGCAGTCAGAAGGGAAGCGGATCAAGATCACACCGGCCGCG
GCTTCATCGGAGCAACCACGAACCGCCGCTCCCTCAGCCCCGAGCACCCCTCCGCCACAGAAAATCGAAAGCATA
GAGGCCTTCGAAGACCGAACACTAAGTGCCGTGTTCAGAGTGACCCTCAAGGAAGAAGGGCATCGTGACATACAT
GGCAGCCGTACATACTTGCCTGGGCTTCGGAGCGAACTGCAGGATGAGGGTCAGGACTTGCGCATCCAGGTTGAG
GTTCTGGACCAGGCCCTCCTAGAGGCTGCGTCAAAGGCCGAGAAGCAGCGTCCACTCGACTATCTGCTGCCGTGC
TGGAAGCGCATCACAAAACTGTACAAGGGATTGAGGCGGACGGGAGATGATGACCCGAAGTATCAGGTTCTGTGT
GAGGCACGGCGCCTGTGTATGAGCTATTGTATCTTTGCGATTACAATGCCAGAGATGTTTGGGAGCGAATGGTCC
CCTCAATCATCGTTAGCCTCGTATCTTCTCATCGACCCCGAGGATGATAGAGGAATTGATTTCGAGTTTATCAAC
GAAGCTGTGAGAAGATTCGACGAAGACGACTCCGTCAAGCCTGCCTTCATCTCTGCCGTCGAGCAGTTGAGCGCG
CAGCTCTCTTCTATGGACGTTAACGATGACTACAAGCCATACGCCATTGCTCTTCGAAACCTTGTTCGCCACGGT
TCCATCGCGGCAGCAATCACAGAATCGTCCATTTTCAACAACACAAGGGACCCTGCTCAATTCGAGAAAGCCACT
CTTTTGGGTCCATGGTTCCGCCTCTCACCCCTTCAAGCTAATGTTACCCTGTCCTATTTCTCTAGCCCCAAGACC
AGGGACCAGGCATACATTTCCAATGCCCAGCGATCGCTCCGAATGACGCAGCAGATGCTCAGTTCTGATCTTCTT
GATGTTATCAACCACCTGATCCGGGCTTCGAAAGAGGCTCGAGATCGTGTTTTAGATTGGTTCGCGACTGCTATG
AACATCAACCACAAACGACGGGCCATGCAGGTTGACCCTGCGCAAGTATCCTCTGACGGCTTCATGTTCAATATT
ACAACTTGCCTCGACCAGCTCTGTGAGCCGTTCATGGATGCAGCATTCACCAAAATCGACAGAGTTGATGCAGAT
TATCTCCACCGCGATTCTCGAGTTGACATGCGGGATGAGACCAAAATCAATGCCGATCAGCATGCCTCCGACGCT
TTCTATTCTAAGAAGGTTGAGGGAACTTCAAACTTTATCACCGAAGTATTCTTCCTGACTGTCGCCGCCCATCAC
TACGGCAGTGAATCATTGACGTCAAAGATGGAGCAACTCGAGAAAGATGTGCGACAGATGGAGAGTACAATCACT
AAATTTGAACTTGAGCGGGTTCGTTGGCTCAACAATCCACAGCAATTGCGCACCTTCGATACGGCCCTGAAGAAG
TACAAAGACAAGCTCGAACTGGGCATCGCTCTCAAATACAGTCTCCAAGGTGTGTTGTTCGACGAGCAGTGGCAG
GCTCGTTCTATGCTATTCATGCGATATGTTACCGTGTGGCTTCTGAGACTTGTCTCTGGAAAGAACTTCCCCAAA
GAGCAAGTTACCCTGCCTCTTCCAGAGGAGCAGCCCGAAGTCTTCAAATGTCTACCAGAGTACTTCTTGGAGGAT
GTTGTCAGTAACTTCAAGTTTATCATGTGGTGCATGCCACAGATCATTACGGCCACCCAGGGAGATGAGCTGGTA
ATGCTGTGCATCACATTCCTAGAGTGCTCGACCTATATTAAGAATCCCTATCTGAAAGCCGGACTGATCTCCATT
CTGTTCCGAGGCACCTGGAAGCGCCCTGGTGGCGCCAGTGGTGTTTTAGTCGACTTGCTCAACAGCATGCCATTT
GCCAACGAACATCTCCTCCATGCGGTCATGAAATTCTATATTGAGGCAGAGTTCACGGGAACACATTCCCAATTC
TACGACAAGTTTAACATCCGTTACGAGATCTTCCAGATCATCAAATGCATCTGGCCCAACACTCTGTATCGGGAG
AAGTTGTCCCTTCAAGCCAATCAGAACCTGGATTTCTTCGTCCAATTCGTTAACCTTCTACTAAACGATGTGACT
TACGTCCTCGATGAATCTTTCGGTGCTTTCAAGACTATCCACAACACTCAGACCGAGCTGAATACACAGGGCAAC
TCAATGGATGCCGCAACCCGCCAACAGCGGGAGGAGAACCTGTCATCAGCGCAGCGCAGCGCCAAGAGCTACATG
CAACTGACTAATCAAACCGTGGCAATGCTCAAGCTATTCACTGAGGCGCTTGCTGACTCGTTCACAATGCCTGAA
ATTGTGCAGCGACTGGCAGACATGCTGGACTACAATCTCGACGCAATGGTGGGACCCAAGAGCTCCAATCTCCGA
GTGGACAACCTGCAGGAATATGGCTTCAATCCCCGCGCTCTTCTGAGTGAGATTGTCGACGTCTATCTTAATCTG
ATCGGCAAGGAAAACTTCATCCTGGCTGTTGCCCGTGATGGCCGATCCTACAAGCCAGCCAATTTCGAGAAGGCG
GCTGATATTATCCGAAAGTGGTCGCTGAAATCCCCCGAGCAGCTTCACCACTGGAGTGAGCTGCAGAAGAAGGTC
CAGGCTGCCAAGGAGGCCGATGATCAAGCGGAGGAAGACATGGGCGAGATCCCTGAAGAGTTCCTCGATCCTCTT
ATGTATTCCCTCATGGATGATCCCGTCATACTTCCCAGCTCACGGATCGCCATCGACCGCGCTACAATTCGCTCG
CATCTCCTGAGTGACCCCCACGATCCATTTAACCGTGTCCCATTGAAGATTGAAGATGTAGTAGCTGATACCGAA
CTTAAAGCCAAGATTGAGGCGTTCAAAAATGAGAAATTAGCTGGCAAACGGAGGGAAATGGTGCATGATCGGATG
GACACTTCAAATTAA
Transcript >Pro_DTO377G3_2|g7156.t1
ATGTCGGACACACTTTCCGACGCAGACAAGATTCGCAACAAGCGACTTGCAAAGCTCTCAAACCCAGGCCAGTCC
TCCGACGGTGCCTCCGAATCGACACAGAGCTCATCTAACACATCTCCGTCACAATCACCACTGTCGGTGCAGCCA
CCGAGTCGCCTTTTCAACGCGCCACCAACCCCGCAGCAGTCAGAAGGGAAGCGGATCAAGATCACACCGGCCGCG
GCTTCATCGGAGCAACCACGAACCGCCGCTCCCTCAGCCCCGAGCACCCCTCCGCCACAGAAAATCGAAAGCATA
GAGGCCTTCGAAGACCGAACACTAAGTGCCGTGTTCAGAGTGACCCTCAAGGAAGAAGGGCATCGTGACATACAT
GGCAGCCGTACATACTTGCCTGGGCTTCGGAGCGAACTGCAGGATGAGGGTCAGGACTTGCGCATCCAGGTTGAG
GTTCTGGACCAGGCCCTCCTAGAGGCTGCGTCAAAGGCCGAGAAGCAGCGTCCACTCGACTATCTGCTGCCGTGC
TGGAAGCGCATCACAAAACTGTACAAGGGATTGAGGCGGACGGGAGATGATGACCCGAAGTATCAGGTTCTGTGT
GAGGCACGGCGCCTGTGTATGAGCTATTGTATCTTTGCGATTACAATGCCAGAGATGTTTGGGAGCGAATGGTCC
CCTCAATCATCGTTAGCCTCGTATCTTCTCATCGACCCCGAGGATGATAGAGGAATTGATTTCGAGTTTATCAAC
GAAGCTGTGAGAAGATTCGACGAAGACGACTCCGTCAAGCCTGCCTTCATCTCTGCCGTCGAGCAGTTGAGCGCG
CAGCTCTCTTCTATGGACGTTAACGATGACTACAAGCCATACGCCATTGCTCTTCGAAACCTTGTTCGCCACGGT
TCCATCGCGGCAGCAATCACAGAATCGTCCATTTTCAACAACACAAGGGACCCTGCTCAATTCGAGAAAGCCACT
CTTTTGGGTCCATGGTTCCGCCTCTCACCCCTTCAAGCTAATGTTACCCTGTCCTATTTCTCTAGCCCCAAGACC
AGGGACCAGGCATACATTTCCAATGCCCAGCGATCGCTCCGAATGACGCAGCAGATGCTCAGTTCTGATCTTCTT
GATGTTATCAACCACCTGATCCGGGCTTCGAAAGAGGCTCGAGATCGTGTTTTAGATTGGTTCGCGACTGCTATG
AACATCAACCACAAACGACGGGCCATGCAGGTTGACCCTGCGCAAGTATCCTCTGACGGCTTCATGTTCAATATT
ACAACTTGCCTCGACCAGCTCTGTGAGCCGTTCATGGATGCAGCATTCACCAAAATCGACAGAGTTGATGCAGAT
TATCTCCACCGCGATTCTCGAGTTGACATGCGGGATGAGACCAAAATCAATGCCGATCAGCATGCCTCCGACGCT
TTCTATTCTAAGAAGGTTGAGGGAACTTCAAACTTTATCACCGAAGTATTCTTCCTGACTGTCGCCGCCCATCAC
TACGGCAGTGAATCATTGACGTCAAAGATGGAGCAACTCGAGAAAGATGTGCGACAGATGGAGAGTACAATCACT
AAATTTGAACTTGAGCGGGTTCGTTGGCTCAACAATCCACAGCAATTGCGCACCTTCGATACGGCCCTGAAGAAG
TACAAAGACAAGCTCGAACTGGGCATCGCTCTCAAATACAGTCTCCAAGGTGTGTTGTTCGACGAGCAGTGGCAG
GCTCGTTCTATGCTATTCATGCGATATGTTACCGTGTGGCTTCTGAGACTTGTCTCTGGAAAGAACTTCCCCAAA
GAGCAAGTTACCCTGCCTCTTCCAGAGGAGCAGCCCGAAGTCTTCAAATGTCTACCAGAGTACTTCTTGGAGGAT
GTTGTCAGTAACTTCAAGTTTATCATGTGGTGCATGCCACAGATCATTACGGCCACCCAGGGAGATGAGCTGGTA
ATGCTGTGCATCACATTCCTAGAGTGCTCGACCTATATTAAGAATCCCTATCTGAAAGCCGGACTGATCTCCATT
CTGTTCCGAGGCACCTGGAAGCGCCCTGGTGGCGCCAGTGGTGTTTTAGTCGACTTGCTCAACAGCATGCCATTT
GCCAACGAACATCTCCTCCATGCGGTCATGAAATTCTATATTGAGGCAGAGTTCACGGGAACACATTCCCAATTC
TACGACAAGTTTAACATCCGTTACGAGATCTTCCAGATCATCAAATGCATCTGGCCCAACACTCTGTATCGGGAG
AAGTTGTCCCTTCAAGCCAATCAGAACCTGGATTTCTTCGTCCAATTCGTTAACCTTCTACTAAACGATGTGACT
TACGTCCTCGATGAATCTTTCGGTGCTTTCAAGACTATCCACAACACTCAGACCGAGCTGAATACACAGGGCAAC
TCAATGGATGCCGCAACCCGCCAACAGCGGGAGGAGAACCTGTCATCAGCGCAGCGCAGCGCCAAGAGCTACATG
CAACTGACTAATCAAACCGTGGCAATGCTCAAGCTATTCACTGAGGCGCTTGCTGACTCGTTCACAATGCCTGAA
ATTGTGCAGCGACTGGCAGACATGCTGGACTACAATCTCGACGCAATGGTGGGACCCAAGAGCTCCAATCTCCGA
GTGGACAACCTGCAGGAATATGGCTTCAATCCCCGCGCTCTTCTGAGTGAGATTGTCGACGTCTATCTTAATCTG
ATCGGCAAGGAAAACTTCATCCTGGCTGTTGCCCGTGATGGCCGATCCTACAAGCCAGCCAATTTCGAGAAGGCG
GCTGATATTATCCGAAAGTGGTCGCTGAAATCCCCCGAGCAGCTTCACCACTGGAGTGAGCTGCAGAAGAAGGTC
CAGGCTGCCAAGGAGGCCGATGATCAAGCGGAGGAAGACATGGGCGAGATCCCTGAAGAGTTCCTCGATCCTCTT
ATGTATTCCCTCATGGATGATCCCGTCATACTTCCCAGCTCACGGATCGCCATCGACCGCGCTACAATTCGCTCG
CATCTCCTGAGTGACCCCCACGATCCATTTAACCGTGTCCCATTGAAGATTGAAGATGTAGTAGCTGATACCGAA
CTTAAAGCCAAGATTGAGGCGTTCAAAAATGAGAAATTAGCTGGCAAACGGAGGGAAATGGTGCATGATCGGATG
GACACTTCAAATTAA
Gene >Pro_DTO377G3_2|g7156.t1
ATGTCGGACACACTTTCCGACGCAGACAAGGTTAGTTTCTTGTTGTACTCGAGCTATGAAGCTATACCGCCCCCG
CAGTGACTCGACTCGAGGACTGACATCTATCTTGATAAAAAAAAGATTCGCAACAAGCGACTTGCAAAGCTCTCA
AACCCAGGCCAGTCCTCCGACGGTGCCTCCGAATCGACACAGAGCTCATCTAACACATCTCCGTCACAATCACCA
CTGTCGGTGCAGCCACCGAGTCGCCTTTTCAACGCGCCACCAACCCCGCAGCAGTCAGAAGGGAAGCGGATCAAG
ATCACACCGGCCGCGGCTTCATCGGAGCAACCACGAACCGCCGCTCCCTCAGCCCCGAGCACCCCTCCGCCACAG
AAAATCGAAAGCATAGAGGCCTTCGAAGACCGAACACTAAGTGCCGTGTTCAGAGTGACCCTCAAGGAAGAAGGG
CATCGTGACATACATGGCAGCCGTACATACTTGCCTGGGCTTCGGAGCGAACTGCAGGATGAGGGTCAGGACTTG
CGCATCCAGGTTGAGGTTCTGGACCAGGCCCTCCTAGAGGCTGCGTCAAAGGCCGAGAAGCAGCGTCCACTCGAC
TATCTGCTGCCGTGCTGGAAGCGCATCACAAAACTGTACAAGGGATTGAGGCGGACGGGAGATGATGACCCGAAG
TATCAGGTTCTGTGTGAGGCACGGCGCCTGTGTATGAGCTATTGTATCTTTGCGATTACAATGCCAGAGATGTTT
GGGTTCGTTCTCTGGAATGCTGCTACACTGGCACTGGATACTGACTGAACTGTAGGAGCGAATGGTCCCCTCAAT
CATCGTTAGCCTCGTATCTTCTCATCGACCCCGAGGATGATAGAGGAATTGATTTCGAGTTTATCAACGAAGCTG
TGAGAAGATTCGACGAAGACGACTCCGTCAAGCCTGCCTTCATCTCTGCCGTCGAGCAGTTGAGCGCGCAGCTCT
CTTCTATGGACGTTAACGATGACTACAAGCCATACGCCATTGTAAGTCAAACGTCACAATTTCCCTGGACCACGT
CTGACCAGTTTGTTCAGGCTCTTCGAAACCTTGTTCGCCACGGTTCCATCGCGGCAGCAATCACAGAATCGTCCA
TTTTCAACAACACAAGGGACCCTGCTCAATTCGAGAAAGCCACTCTTTTGGGTCCATGGTTCCGCCTCTCACCCC
TTCAAGCTAATGTTACCCTGTCCTATTTCTCTAGCCCCAAGACCAGGGACCAGGCATACATTTCCAATGCCCAGC
GATCGCTCCGAATGACGCAGCAGATGCTCAGTTCTGATCTTCTTGATGTTATCAACCACCTGATCCGGGCTTCGA
AAGAGGCTCGAGATCGTGTTTTAGATTGGTTCGCGACTGCTATGAACATCAACCACAAACGACGGGCCATGCAGG
TTGACCCTGCGCAAGTATCCTCTGACGGCTTCATGTTCAATATTACAACTTGCCTCGACCAGCTCTGTGAGCCGT
TCATGGATGCAGCATTCACCAAAATCGACAGAGTTGATGCAGATTATCTCCACCGCGATTCTCGAGTTGACATGC
GGGATGAGACCAAAATCAATGCCGATCAGCATGCCTCCGACGCTTTCTATTCTAAGAAGGTTGAGGGAACTTCAA
ACTTTATCACCGAAGTATTCTTCCTGACTGTCGCCGCCCATCACTACGGCAGTGAATCATTGACGTCAAAGATGG
AGCAACTCGAGAAAGATGTGCGACAGATGGAGAGTACAATCACTAAATTTGAACTTGAGCGGGTTCGTTGGCTCA
ACAATCCACAGCAATTGCGCACCTTCGATACGGCCCTGAAGAAGTACAAAGACAAGCTCGAACTGGGCATCGCTC
TCAAATACAGTCTCCAAGGTGTGTTGTTCGACGAGCAGTGGCAGGCTCGTTCTATGCTATTCATGCGATATGTTA
CCGTGTGGCTTCTGAGACTTGTCTCTGGAAAGAACTTCCCCAAAGAGCAAGTTACCCTGCCTCTTCCAGAGGAGC
AGCCCGAAGTCTTCAAATGTCTACCAGAGTACTTCTTGGAGGATGTTGTCAGTAACTTCAAGTTTATCATGTGGT
GCATGCCACAGATCATTACGGCCACCCAGGGAGATGAGCTGGTAATGCTGTGCATCACATTCCTAGAGTGCTCGA
CCTATATTAAGAATCCCTATCTGAAAGCCGGACTGATCTCCATTCTGTTCCGAGGCACCTGGAAGCGCCCTGGTG
GCGCCAGTGGTGTTTTAGTCGACTTGCTCAACAGCATGCCATTTGCCAACGAACATCTCCTCCATGCGGTCATGA
AATTCTATATTGAGGCAGAGTTCACGGGAACACATTCCCAATTCTACGACAAGTTTAACATCCGTTACGAGATCT
TCCAGATCATCAAATGCATCTGGCCCAACACTCTGTATCGGGAGAAGTTGTCCCTTCAAGCCAATCAGAACCTGG
ATTTCTTCGTCCAATTCGTTAACCTTCTACTAAACGATGTGACTTACGTCCTCGATGAATCTTTCGGTGCTTTCA
AGACTATCCACAACACTCAGACCGAGCTGAATACACAGGGCAACTCAATGGATGCCGCAACCCGCCAACAGCGGG
AGGAGAACCTGTCATCAGCGCAGCGCAGCGCCAAGAGCTACATGCAACTGACTAATCAAACCGTGGCAATGCTCA
AGCTATTCACTGAGGCGCTTGCTGACTCGTTCACAATGCCTGAAATTGTGCAGCGACTGGCAGACATGCTGGACT
ACAATCTCGACGCAATGGTGGGACCCAAGAGCTCCAATCTCCGAGTGGACAACCTGCAGGAATATGGCTTCAATC
CCCGCGCTCTTCTGAGTGAGATTGTCGACGTCTATCTTAATCTGATCGGCAAGGAAAACTTCATCCTGGCTGTTG
CCCGTGATGGCCGATCCTACAAGCCAGCCAATTTCGAGAAGGCGGCTGATATTATCCGAAAGTGGTCGCTGAAAT
CCCCCGAGCAGCTTCACCACTGGAGTGAGCTGCAGAAGAAGGTCCAGGCTGCCAAGGAGGCCGATGATCAAGCGG
AGGAAGACATGGGCGAGATCCCTGAAGAGTTCCTCGGTATTTTTCCCTTTTTGAACTATCCCTTTTCGACAGCTG
CTAATTTTTTAGATCCTCTTATGTATTCCCTCATGGATGATCCCGTCATACTTCCCAGCTCACGGATCGCCATCG
ACCGCGCTACAATTCGCTCGCATCTCCTGAGTGACCCCCACGATCCATTTAACCGTGTCCCATTGAAGATTGAAG
ATGTAGTAGCTGGTAAGTAATTTTCTTTCCCAGGTATTGTTCCAATACCAGTATTAACCACCTTTCTAGATACCG
AACTTAAAGCCAAGATTGAGGCGTTCAAAAATGAGAAATTAGCTGGCAAACGGAGGGAAATGGTGCATGATCGGA
TGGACACTTCAAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail