Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7155.t1
Gene name
Locationscaffold_21:207008..208124
Strand-
Gene length (bp)1116
Transcript length (bp)1062
Coding sequence length (bp)1062
Protein length (aa) 354

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02544 Steroid_dh 3-oxo-5-alpha-steroid 4-dehydrogenase 3.8E-06 229 263

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0008150 biological_process No
GO:0016491 oxidoreductase activity No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 59 81 22
3 96 118 22
4 131 153 22
5 173 195 22
6 255 277 22
7 292 314 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7155.t1
MGATISTCLGALPPAVELFPPSPTVYTSVICCFQYFPLVTAIQWILSWHPAGKTSSESIFNIPGRIAWSAMEIVG
PINLIYSMVTPSPYAPSFTDLPVSNILIVTLYCTHYFNRAIISPFFSAPSMSPIHASIMVFAMVFNWFNSACLAG
WLRGYTVPIIPSFTASSGSPRSAVVDLLPTAGVILFAIGMAGNIYSETALFRLRREEAEKRAAKKADDQPRAGGN
MFHKVYVIPPSRGVFRYILYPHYVFEWLEWIGFALAGTAVVPFSALPASVSATSAITPPLVLAPWLVPAAWAANK
LAVPLPLPAVVFVVNAVTNMLPHARWGRKWYVEKFGENGVAGRGAVVPGCAWM*
Coding >Pro_DTO377G3_2|g7155.t1
ATGGGTGCGACTATTTCCACTTGCTTGGGAGCTCTGCCTCCTGCTGTGGAGCTCTTCCCTCCATCCCCAACTGTC
TACACCTCTGTTATATGCTGCTTCCAATACTTTCCCCTGGTGACGGCAATTCAATGGATTCTGTCCTGGCACCCA
GCAGGCAAAACCTCCTCGGAGTCCATCTTCAACATCCCAGGACGTATCGCCTGGTCTGCCATGGAGATTGTCGGC
CCTATCAACTTGATCTATAGCATGGTCACTCCATCGCCATATGCACCCTCTTTCACTGATCTCCCTGTTTCCAAC
ATCCTCATCGTAACTCTGTACTGCACACACTATTTCAACCGCGCTATCATCTCCCCTTTCTTCTCCGCGCCTAGT
ATGTCCCCAATCCACGCCAGCATCATGGTCTTCGCCATGGTCTTCAATTGGTTCAACTCCGCCTGTCTGGCCGGC
TGGTTGCGCGGATATACAGTGCCGATTATCCCAAGCTTCACGGCTAGCAGCGGAAGTCCCCGCTCCGCGGTGGTA
GATCTCCTCCCCACCGCGGGCGTAATCTTATTTGCTATCGGAATGGCCGGCAACATCTACTCAGAGACAGCCCTG
TTCCGACTTCGGCGCGAAGAGGCCGAAAAGCGCGCTGCCAAAAAGGCAGATGACCAACCTCGGGCGGGGGGAAAC
ATGTTCCACAAGGTCTACGTCATCCCACCCTCTCGTGGTGTCTTCCGATACATTTTGTATCCGCACTACGTGTTC
GAGTGGCTCGAATGGATTGGCTTTGCTCTGGCTGGTACGGCAGTTGTCCCCTTCTCCGCCCTGCCGGCCTCTGTC
TCGGCGACTTCGGCCATCACTCCCCCGCTGGTTCTAGCGCCGTGGTTGGTGCCTGCTGCGTGGGCGGCTAATAAG
CTCGCTGTGCCGCTGCCTTTGCCGGCTGTGGTGTTTGTTGTCAATGCGGTCACGAATATGTTGCCCCATGCGCGC
TGGGGACGAAAGTGGTATGTTGAGAAGTTTGGGGAGAACGGTGTTGCTGGGAGGGGCGCTGTAGTCCCTGGGTGT
GCGTGGATGTGA
Transcript >Pro_DTO377G3_2|g7155.t1
ATGGGTGCGACTATTTCCACTTGCTTGGGAGCTCTGCCTCCTGCTGTGGAGCTCTTCCCTCCATCCCCAACTGTC
TACACCTCTGTTATATGCTGCTTCCAATACTTTCCCCTGGTGACGGCAATTCAATGGATTCTGTCCTGGCACCCA
GCAGGCAAAACCTCCTCGGAGTCCATCTTCAACATCCCAGGACGTATCGCCTGGTCTGCCATGGAGATTGTCGGC
CCTATCAACTTGATCTATAGCATGGTCACTCCATCGCCATATGCACCCTCTTTCACTGATCTCCCTGTTTCCAAC
ATCCTCATCGTAACTCTGTACTGCACACACTATTTCAACCGCGCTATCATCTCCCCTTTCTTCTCCGCGCCTAGT
ATGTCCCCAATCCACGCCAGCATCATGGTCTTCGCCATGGTCTTCAATTGGTTCAACTCCGCCTGTCTGGCCGGC
TGGTTGCGCGGATATACAGTGCCGATTATCCCAAGCTTCACGGCTAGCAGCGGAAGTCCCCGCTCCGCGGTGGTA
GATCTCCTCCCCACCGCGGGCGTAATCTTATTTGCTATCGGAATGGCCGGCAACATCTACTCAGAGACAGCCCTG
TTCCGACTTCGGCGCGAAGAGGCCGAAAAGCGCGCTGCCAAAAAGGCAGATGACCAACCTCGGGCGGGGGGAAAC
ATGTTCCACAAGGTCTACGTCATCCCACCCTCTCGTGGTGTCTTCCGATACATTTTGTATCCGCACTACGTGTTC
GAGTGGCTCGAATGGATTGGCTTTGCTCTGGCTGGTACGGCAGTTGTCCCCTTCTCCGCCCTGCCGGCCTCTGTC
TCGGCGACTTCGGCCATCACTCCCCCGCTGGTTCTAGCGCCGTGGTTGGTGCCTGCTGCGTGGGCGGCTAATAAG
CTCGCTGTGCCGCTGCCTTTGCCGGCTGTGGTGTTTGTTGTCAATGCGGTCACGAATATGTTGCCCCATGCGCGC
TGGGGACGAAAGTGGTATGTTGAGAAGTTTGGGGAGAACGGTGTTGCTGGGAGGGGCGCTGTAGTCCCTGGGTGT
GCGTGGATGTGA
Gene >Pro_DTO377G3_2|g7155.t1
ATGGGTGCGACTATTTCCACTTGCTTGGGAGCTCTGCCTCCTGCTGTGGAGCTCTTCCCTCCATCCCCAACTGTC
TACACCTCTGTTATATGCTGCTTCCAATACTTTCCCCTGGTCAGGACCCTGAAGCCTTGGAGAGATGCTACCAGA
CTAACTCGGGACATTTAGGTGACGGCAATTCAATGGATTCTGTCCTGGCACCCAGCAGGCAAAACCTCCTCGGAG
TCCATCTTCAACATCCCAGGACGTATCGCCTGGTCTGCCATGGAGATTGTCGGCCCTATCAACTTGATCTATAGC
ATGGTCACTCCATCGCCATATGCACCCTCTTTCACTGATCTCCCTGTTTCCAACATCCTCATCGTAACTCTGTAC
TGCACACACTATTTCAACCGCGCTATCATCTCCCCTTTCTTCTCCGCGCCTAGTATGTCCCCAATCCACGCCAGC
ATCATGGTCTTCGCCATGGTCTTCAATTGGTTCAACTCCGCCTGTCTGGCCGGCTGGTTGCGCGGATATACAGTG
CCGATTATCCCAAGCTTCACGGCTAGCAGCGGAAGTCCCCGCTCCGCGGTGGTAGATCTCCTCCCCACCGCGGGC
GTAATCTTATTTGCTATCGGAATGGCCGGCAACATCTACTCAGAGACAGCCCTGTTCCGACTTCGGCGCGAAGAG
GCCGAAAAGCGCGCTGCCAAAAAGGCAGATGACCAACCTCGGGCGGGGGGAAACATGTTCCACAAGGTCTACGTC
ATCCCACCCTCTCGTGGTGTCTTCCGATACATTTTGTATCCGCACTACGTGTTCGAGTGGCTCGAATGGATTGGC
TTTGCTCTGGCTGGTACGGCAGTTGTCCCCTTCTCCGCCCTGCCGGCCTCTGTCTCGGCGACTTCGGCCATCACT
CCCCCGCTGGTTCTAGCGCCGTGGTTGGTGCCTGCTGCGTGGGCGGCTAATAAGCTCGCTGTGCCGCTGCCTTTG
CCGGCTGTGGTGTTTGTTGTCAATGCGGTCACGAATATGTTGCCCCATGCGCGCTGGGGACGAAAGTGGTATGTT
GAGAAGTTTGGGGAGAACGGTGTTGCTGGGAGGGGCGCTGTAGTCCCTGGGTGTGCGTGGATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail