Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7119.t1
Gene name
Locationscaffold_21:107562..109202
Strand-
Gene length (bp)1640
Transcript length (bp)1371
Coding sequence length (bp)1371
Protein length (aa) 457

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16491 Peptidase_M48_N CAAX prenyl protease N-terminal, five membrane helices 4.8E-65 40 224
PF01435 Peptidase_M48 Peptidase family M48 2.4E-45 228 430

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004222 metalloendopeptidase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0006807 nitrogen compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008233 peptidase activity No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0008237 metallopeptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0004175 endopeptidase activity No
GO:0044238 primary metabolic process No
GO:0016787 hydrolase activity No
GO:0043170 macromolecule metabolic process No
GO:0140096 catalytic activity, acting on a protein No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22
2 124 146 22
3 166 188 22
4 195 217 22
5 310 329 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7119.t1
MYILEQLARLLDRPLFPWKNVLVGFSVGQFVLEGFLSLRQYKFLQRTKPPQVLEGEVTQKVFDQSQAYGRAKAKF
GFISGLYGQVQNLAFIYGDVLPKIWGLSGLVLARYLPGRFQGEICQTLVFFFGFNIISTILSLPISYYNTFVLEE
KFGFNKQTVKLWITDMLKGQMLGIVLGTPIITAVLKIVQKFDTSFYYYLWLFGVFLQIFAITIYPIAILPLFNKL
SPLQPGELKTGVENLAKRLNFPLSELHVIDGSKRSAHSNAYFYGLPWKKHIVIYDTLIEKTEPEEVVAVLGHELG
HWSLSHTTKLFGIAQAHMFYIFALFSVFVNNKSLYQSFGFINEQPIMIGFLLFSDALAPMDAVVKLLMNILSRKF
EFEADKFAQNLGYSDKLASSLLKLQIQNLSTMDADPIYASYHYSHPILTERLAALGWKGGKVTSNKEEDSEKPVK
AADREL*
Coding >Pro_DTO377G3_2|g7119.t1
ATGTATATCCTCGAGCAATTGGCGCGTTTGCTCGATCGCCCGCTCTTCCCATGGAAGAACGTGCTTGTGGGATTT
TCAGTGGGCCAGTTCGTCCTTGAGGGTTTCCTGTCACTTCGGCAGTACAAGTTTTTGCAACGGACAAAGCCTCCC
CAGGTCCTCGAAGGGGAGGTTACCCAGAAGGTCTTTGACCAGAGTCAGGCATACGGTCGCGCAAAGGCCAAGTTC
GGCTTCATCTCTGGTCTTTACGGTCAAGTCCAAAACCTTGCTTTCATCTACGGCGATGTCCTCCCCAAGATCTGG
GGCCTCAGCGGTCTGGTGCTGGCTCGGTATCTCCCCGGTCGGTTCCAAGGCGAAATTTGTCAGACATTGGTATTC
TTCTTCGGTTTCAACATTATAAGCACTATCCTCTCGCTGCCCATCTCGTACTACAACACGTTTGTGCTTGAGGAG
AAGTTCGGTTTCAACAAGCAGACGGTCAAGCTCTGGATTACGGATATGCTCAAGGGGCAGATGCTCGGAATTGTT
CTGGGTACTCCTATTATCACTGCCGTTCTTAAGATTGTTCAGAAGTTTGACACCTCCTTCTACTACTACCTCTGG
CTCTTCGGTGTCTTCCTCCAGATCTTCGCCATTACTATCTACCCCATTGCGATTCTGCCTCTGTTCAACAAGCTC
TCGCCTCTTCAGCCCGGCGAACTCAAGACCGGTGTCGAGAACTTGGCTAAGAGACTCAACTTCCCTCTCTCCGAG
CTCCATGTCATTGACGGCAGCAAGCGCAGTGCCCACAGCAATGCCTACTTCTATGGTCTGCCATGGAAGAAGCAC
ATTGTCATCTACGATACTTTGATTGAGAAGACCGAGCCGGAGGAGGTTGTTGCTGTGCTTGGCCATGAGCTTGGC
CACTGGAGCCTCAGCCACACCACCAAGCTCTTCGGCATTGCCCAGGCCCACATGTTCTACATTTTCGCTCTCTTC
TCCGTCTTTGTCAACAACAAGTCGTTGTACCAGTCCTTCGGATTCATCAACGAACAGCCTATCATGATTGGTTTC
CTGCTCTTCTCCGACGCCCTGGCTCCTATGGATGCTGTCGTGAAGCTTCTCATGAACATCCTCAGCCGAAAATTC
GAATTTGAGGCCGATAAATTCGCCCAGAACCTCGGTTACTCTGACAAGCTCGCTTCCTCGCTACTGAAGCTCCAG
ATCCAGAACTTGAGCACTATGGATGCCGATCCGATTTATGCTAGCTACCACTACTCCCACCCCATCCTCACCGAG
CGTCTCGCTGCGCTTGGCTGGAAGGGTGGCAAGGTCACTAGCAACAAGGAGGAGGACAGTGAAAAGCCTGTCAAG
GCCGCAGATCGCGAGCTGTAA
Transcript >Pro_DTO377G3_2|g7119.t1
ATGTATATCCTCGAGCAATTGGCGCGTTTGCTCGATCGCCCGCTCTTCCCATGGAAGAACGTGCTTGTGGGATTT
TCAGTGGGCCAGTTCGTCCTTGAGGGTTTCCTGTCACTTCGGCAGTACAAGTTTTTGCAACGGACAAAGCCTCCC
CAGGTCCTCGAAGGGGAGGTTACCCAGAAGGTCTTTGACCAGAGTCAGGCATACGGTCGCGCAAAGGCCAAGTTC
GGCTTCATCTCTGGTCTTTACGGTCAAGTCCAAAACCTTGCTTTCATCTACGGCGATGTCCTCCCCAAGATCTGG
GGCCTCAGCGGTCTGGTGCTGGCTCGGTATCTCCCCGGTCGGTTCCAAGGCGAAATTTGTCAGACATTGGTATTC
TTCTTCGGTTTCAACATTATAAGCACTATCCTCTCGCTGCCCATCTCGTACTACAACACGTTTGTGCTTGAGGAG
AAGTTCGGTTTCAACAAGCAGACGGTCAAGCTCTGGATTACGGATATGCTCAAGGGGCAGATGCTCGGAATTGTT
CTGGGTACTCCTATTATCACTGCCGTTCTTAAGATTGTTCAGAAGTTTGACACCTCCTTCTACTACTACCTCTGG
CTCTTCGGTGTCTTCCTCCAGATCTTCGCCATTACTATCTACCCCATTGCGATTCTGCCTCTGTTCAACAAGCTC
TCGCCTCTTCAGCCCGGCGAACTCAAGACCGGTGTCGAGAACTTGGCTAAGAGACTCAACTTCCCTCTCTCCGAG
CTCCATGTCATTGACGGCAGCAAGCGCAGTGCCCACAGCAATGCCTACTTCTATGGTCTGCCATGGAAGAAGCAC
ATTGTCATCTACGATACTTTGATTGAGAAGACCGAGCCGGAGGAGGTTGTTGCTGTGCTTGGCCATGAGCTTGGC
CACTGGAGCCTCAGCCACACCACCAAGCTCTTCGGCATTGCCCAGGCCCACATGTTCTACATTTTCGCTCTCTTC
TCCGTCTTTGTCAACAACAAGTCGTTGTACCAGTCCTTCGGATTCATCAACGAACAGCCTATCATGATTGGTTTC
CTGCTCTTCTCCGACGCCCTGGCTCCTATGGATGCTGTCGTGAAGCTTCTCATGAACATCCTCAGCCGAAAATTC
GAATTTGAGGCCGATAAATTCGCCCAGAACCTCGGTTACTCTGACAAGCTCGCTTCCTCGCTACTGAAGCTCCAG
ATCCAGAACTTGAGCACTATGGATGCCGATCCGATTTATGCTAGCTACCACTACTCCCACCCCATCCTCACCGAG
CGTCTCGCTGCGCTTGGCTGGAAGGGTGGCAAGGTCACTAGCAACAAGGAGGAGGACAGTGAAAAGCCTGTCAAG
GCCGCAGATCGCGAGCTGTAA
Gene >Pro_DTO377G3_2|g7119.t1
ATGTATATCCTCGAGGTAAGTTGATTTGATTGATACTATCATGTTTATACGGTAAATATGCTTTCCACCGTGGAC
ACGTCGCTAATAACTGTCCTCCAGCAATTGGCGCGTTTGCTCGATCGCCCGCTCTTCCCATGGAAGAACGTGCTT
GTGGGATTTTCAGTGGGCCAGTTCGTCCTTGAGGGTTTCCTGTCACTTCGGCAGTACAAGTTTTTGCAACGGACA
AAGCCTCCCCAGGTCCTCGAAGGGGAGGTTACCCAGAAGGTCTTTGACCAGAGTCAGGTATGAACCCGATGACGG
GGAATTATATCATATACAGAGGCTTACTGAAACATCACTACAGGCATACGGTCGCGCAAAGGCCAAGTTCGGCTT
CATCTCTGGTCTTTACGGTCAAGTCCAAAACCTTGCTTTCATCTACGGCGATGTCCTCCCCAAGATCTGGGGCCT
CAGCGGTCTGGTGCTGGCTCGGTATCTCCCCGGTCGGTTCCAAGGCGAAATTTGTCAGACATTGGTATTCTTCTT
CGGTTTCAACATTATAAGCACTATCCTCTCGCTGCCCATCTCGTACTACAACACGTTTGTGCTTGAGGAGAAGTT
CGGTTTCAACAAGCAGACGGTCAAGCTCTGGATTACGGATATGCTCAAGGGGCAGATGCTCGGAATTGTTCTGGG
TACTCCTATTATCACTGCCGTTCTTAAGATTGTTCAGAAGTTTGACACCTCCTTCTACTACTACCTCTGGCTCTT
CGGTGTCTTCCTCCAGATCTTCGCCATTACTATCTACCCCATTGCGATTCTGCCTCTGTTCAACAAGCTCTCGCC
TCTTCAGCCCGGCGAACTCAAGACCGGTGTCGAGAACTTGGCTAAGAGACTCAACTTCCCTCTCTCCGAGCTCCA
TGTCATTGACGGCAGCAAGCGCAGTGCCCACAGCAATGCCTACTTCTATGGTCTGCCATGGAAGAAGCACATTGT
CATCTACGATACTTTGATTGAGAAGACCGAGCCGGAGGAGGTTGTTGCTGTGCTTGGCCATGAGCTTGGCCACTG
GAGCCTCAGCCACACCACCAAGCTCTTCGGCATTGCCCAGGTACGAATTTGTTCAGTTGCTCTTTTGGCGAATTA
TCACTAACTATGTAATCCAGGCCCACATGTTCTACATTTTCGCTCTCTTCTCCGTCTTTGTCAACAACAAGTCGT
TGTACCAGTCCTTCGGATTCATCAACGAACAGCCTATCATGATTGGTTTCCTGCTCTTCTCCGACGCCCTGGCTC
CTATGGATGCTGTCGTGAAGCTTCTCATGAACATCCTCAGCCGAAAATTCGAATTTGAGGCCGGTATGTTCCATT
CGATCCATCACATTTACACTCGGTTTTACACTCGGTTTTACTAACAATGTTCCACAGATAAATTCGCCCAGAACC
TCGGTTACTCTGACAAGCTCGCTTCCTCGCTACTGAAGCTCCAGATCCAGAACTTGAGCACTATGGATGCCGATC
CGATTTATGCTAGCTACCACTACTCCCACCCCATCCTCACCGAGCGTCTCGCTGCGCTTGGCTGGAAGGGTGGCA
AGGTCACTAGCAACAAGGAGGAGGACAGTGAAAAGCCTGTCAAGGCCGCAGATCGCGAGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail