Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g711.t1
Gene name
Locationscaffold_01:1844544..1846841
Strand+
Gene length (bp)2297
Transcript length (bp)2241
Coding sequence length (bp)2241
Protein length (aa) 747

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02065 Melibiase Melibiase 9.3E-149 306 655
PF16875 Glyco_hydro_36N Glycosyl hydrolase family 36 N-terminal domain 9.3E-82 85 301
PF16874 Glyco_hydro_36C Glycosyl hydrolase family 36 C-terminal domain 2.4E-21 668 743

GO

GO Term Description Terminal node
GO:0004557 alpha-galactosidase activity Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0008150 biological_process No
GO:0015925 galactosidase activity No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g711.t1
MVHLSRGVVATCLTLLAHSSGITAEESSTNPIVADGTSFALNGNNVAYRIHVDNTTGDLLGDHFGGSVGAHIPLE
VVGDVHGWNGYIGRVRREFPDQGRGDFRTPAIRIRQSQGYTVSEFQYKSYKIIPGKPALPGLPATTGTEEDVSTL
VISLYDKYSDVGADLSYSIFPKYDAIVRSVNITNHGKANITIESLASLSVDLPFEDLDMISLRGDWAREAHRERK
KVTYGTQGFGSSTGYSSHLHNPFLALTEPSATESHGEVWGFSLVYTGSFSVNVEKGSQGFTRALLGFNPSQLSWN
LPPGETLTSPECVSVYSKDGIGGMSRSLHRLYRKHLIKSKFATSDRPTLLNSWEGLYFDYNQSSIYDLAKEAAEV
GAKLFVLDDGWFGREYPRLSDDAGLGDWIPNPDRFPDGLGPIVKNITDLKAANSSTNMRFGIWFEPEMVNPNSTL
YNEHPDWALHAGPYPRTERRNQLVLNLALPEVQDYIIKSVSDVLKSADISYVKWDNNRGIHEMPSPATDHAYILG
MYRVFDELTTQFPDILWEGCASGGGRFDPGVLQYFPQIWTSDNTDAIDRISIQLGTSLAYPPSAMGAHLSEVPNQ
QTGRTVPVAVRGHVAMMAGSFGLELDPAVMNAEDKAALPGLIALAEKVNPIVLTGDMWRLNLPEDSNWPAVLFIA
EDGQKAVLFVFQLAPNVDHSWPRVRLQGLDAQASYKIDGGVVYSGGTLMNIGLQFPFKGDYGSQVVMLEKQ*
Coding >Pro_DTO377G3_2|g711.t1
ATGGTTCACTTATCAAGGGGTGTTGTGGCCACATGTCTTACTCTCCTTGCGCATTCCTCCGGTATTACGGCTGAA
GAATCAAGCACAAATCCAATCGTGGCAGATGGTACTTCCTTTGCTCTCAATGGAAATAATGTTGCATACCGCATC
CATGTAGACAATACCACTGGTGATCTCTTAGGAGACCACTTCGGCGGCTCTGTCGGAGCTCATATCCCTCTGGAA
GTTGTAGGCGACGTCCATGGCTGGAATGGTTATATCGGACGTGTACGCCGCGAGTTCCCAGACCAAGGCCGAGGA
GATTTCAGGACCCCTGCGATTCGCATTCGTCAGTCACAAGGGTATACCGTGTCTGAATTCCAGTACAAATCGTAC
AAGATCATCCCCGGAAAGCCTGCTCTACCTGGGTTGCCAGCCACGACGGGCACAGAAGAAGATGTGAGCACCTTG
GTTATCAGTCTATATGACAAGTACAGCGATGTTGGTGCAGACCTCTCCTACTCGATTTTCCCTAAGTATGATGCC
ATTGTGCGCAGCGTGAATATCACGAATCACGGAAAGGCAAATATCACAATCGAGTCTCTGGCAAGTCTGAGCGTG
GATTTGCCGTTCGAGGACCTCGACATGATAAGTCTTCGCGGTGATTGGGCAAGGGAAGCGCATCGCGAAAGGAAA
AAGGTCACGTACGGCACCCAAGGCTTTGGAAGTTCCACTGGCTACTCCTCTCACCTCCATAACCCTTTCCTGGCA
TTGACAGAGCCTTCCGCTACCGAGTCTCACGGAGAGGTATGGGGATTCTCGCTTGTGTACACTGGTTCATTCTCC
GTGAATGTCGAGAAGGGCTCGCAGGGCTTCACGCGTGCCCTTTTGGGTTTCAACCCTAGCCAGCTCTCGTGGAAT
CTGCCGCCCGGGGAAACCCTTACTTCTCCCGAGTGTGTCTCGGTATACTCCAAGGATGGCATCGGCGGAATGTCA
CGCTCTCTACATCGCCTGTACCGCAAGCATCTCATCAAGAGCAAGTTTGCCACCAGTGATCGTCCTACGTTGTTG
AACAGTTGGGAAGGATTGTATTTCGATTACAATCAGAGTAGCATCTACGACTTGGCAAAGGAAGCCGCCGAAGTA
GGTGCCAAGCTCTTTGTTCTGGATGACGGTTGGTTTGGCCGGGAATATCCACGTCTCTCCGACGACGCCGGACTG
GGCGACTGGATCCCAAACCCTGACCGGTTCCCAGACGGCCTGGGGCCGATTGTGAAGAATATCACGGACCTGAAA
GCAGCTAACTCGTCAACGAACATGCGCTTCGGTATCTGGTTCGAGCCGGAAATGGTCAATCCGAACTCGACTCTG
TATAACGAGCACCCGGACTGGGCCTTACACGCAGGACCCTACCCTCGCACCGAAAGGCGCAATCAGCTCGTGCTG
AATCTCGCTCTTCCTGAAGTCCAAGACTACATCATCAAGTCCGTCTCAGACGTCCTCAAGAGTGCAGATATCAGT
TACGTCAAGTGGGACAACAACAGGGGTATCCACGAGATGCCTTCCCCGGCCACAGACCACGCCTATATTCTCGGT
ATGTACCGTGTTTTCGATGAACTAACAACCCAATTCCCTGATATCCTCTGGGAGGGCTGCGCCTCGGGCGGAGGC
CGGTTCGACCCAGGTGTTCTGCAGTACTTCCCTCAGATCTGGACATCGGATAACACAGATGCAATCGATCGCATC
TCCATTCAGCTTGGTACTTCGCTCGCCTACCCGCCCAGCGCGATGGGTGCTCACCTGTCCGAAGTACCGAACCAA
CAGACTGGCCGCACAGTCCCGGTGGCTGTCCGCGGACATGTCGCGATGATGGCTGGCTCGTTTGGCTTGGAGCTC
GATCCGGCTGTAATGAACGCGGAGGACAAGGCGGCTCTGCCGGGTCTCATTGCTCTTGCTGAGAAGGTGAACCCC
ATTGTCCTTACTGGCGATATGTGGCGTTTGAACCTTCCAGAGGACTCGAATTGGCCTGCTGTTTTGTTCATCGCC
GAAGATGGTCAGAAGGCTGTGTTGTTTGTCTTCCAGCTCGCTCCGAATGTTGATCATTCATGGCCACGCGTTAGG
TTGCAGGGATTGGATGCGCAGGCTTCCTATAAGATTGACGGGGGTGTGGTTTACTCCGGTGGAACCTTGATGAAT
ATTGGTCTGCAATTTCCTTTCAAAGGTGACTATGGCAGTCAGGTTGTGATGTTAGAAAAGCAATAG
Transcript >Pro_DTO377G3_2|g711.t1
ATGGTTCACTTATCAAGGGGTGTTGTGGCCACATGTCTTACTCTCCTTGCGCATTCCTCCGGTATTACGGCTGAA
GAATCAAGCACAAATCCAATCGTGGCAGATGGTACTTCCTTTGCTCTCAATGGAAATAATGTTGCATACCGCATC
CATGTAGACAATACCACTGGTGATCTCTTAGGAGACCACTTCGGCGGCTCTGTCGGAGCTCATATCCCTCTGGAA
GTTGTAGGCGACGTCCATGGCTGGAATGGTTATATCGGACGTGTACGCCGCGAGTTCCCAGACCAAGGCCGAGGA
GATTTCAGGACCCCTGCGATTCGCATTCGTCAGTCACAAGGGTATACCGTGTCTGAATTCCAGTACAAATCGTAC
AAGATCATCCCCGGAAAGCCTGCTCTACCTGGGTTGCCAGCCACGACGGGCACAGAAGAAGATGTGAGCACCTTG
GTTATCAGTCTATATGACAAGTACAGCGATGTTGGTGCAGACCTCTCCTACTCGATTTTCCCTAAGTATGATGCC
ATTGTGCGCAGCGTGAATATCACGAATCACGGAAAGGCAAATATCACAATCGAGTCTCTGGCAAGTCTGAGCGTG
GATTTGCCGTTCGAGGACCTCGACATGATAAGTCTTCGCGGTGATTGGGCAAGGGAAGCGCATCGCGAAAGGAAA
AAGGTCACGTACGGCACCCAAGGCTTTGGAAGTTCCACTGGCTACTCCTCTCACCTCCATAACCCTTTCCTGGCA
TTGACAGAGCCTTCCGCTACCGAGTCTCACGGAGAGGTATGGGGATTCTCGCTTGTGTACACTGGTTCATTCTCC
GTGAATGTCGAGAAGGGCTCGCAGGGCTTCACGCGTGCCCTTTTGGGTTTCAACCCTAGCCAGCTCTCGTGGAAT
CTGCCGCCCGGGGAAACCCTTACTTCTCCCGAGTGTGTCTCGGTATACTCCAAGGATGGCATCGGCGGAATGTCA
CGCTCTCTACATCGCCTGTACCGCAAGCATCTCATCAAGAGCAAGTTTGCCACCAGTGATCGTCCTACGTTGTTG
AACAGTTGGGAAGGATTGTATTTCGATTACAATCAGAGTAGCATCTACGACTTGGCAAAGGAAGCCGCCGAAGTA
GGTGCCAAGCTCTTTGTTCTGGATGACGGTTGGTTTGGCCGGGAATATCCACGTCTCTCCGACGACGCCGGACTG
GGCGACTGGATCCCAAACCCTGACCGGTTCCCAGACGGCCTGGGGCCGATTGTGAAGAATATCACGGACCTGAAA
GCAGCTAACTCGTCAACGAACATGCGCTTCGGTATCTGGTTCGAGCCGGAAATGGTCAATCCGAACTCGACTCTG
TATAACGAGCACCCGGACTGGGCCTTACACGCAGGACCCTACCCTCGCACCGAAAGGCGCAATCAGCTCGTGCTG
AATCTCGCTCTTCCTGAAGTCCAAGACTACATCATCAAGTCCGTCTCAGACGTCCTCAAGAGTGCAGATATCAGT
TACGTCAAGTGGGACAACAACAGGGGTATCCACGAGATGCCTTCCCCGGCCACAGACCACGCCTATATTCTCGGT
ATGTACCGTGTTTTCGATGAACTAACAACCCAATTCCCTGATATCCTCTGGGAGGGCTGCGCCTCGGGCGGAGGC
CGGTTCGACCCAGGTGTTCTGCAGTACTTCCCTCAGATCTGGACATCGGATAACACAGATGCAATCGATCGCATC
TCCATTCAGCTTGGTACTTCGCTCGCCTACCCGCCCAGCGCGATGGGTGCTCACCTGTCCGAAGTACCGAACCAA
CAGACTGGCCGCACAGTCCCGGTGGCTGTCCGCGGACATGTCGCGATGATGGCTGGCTCGTTTGGCTTGGAGCTC
GATCCGGCTGTAATGAACGCGGAGGACAAGGCGGCTCTGCCGGGTCTCATTGCTCTTGCTGAGAAGGTGAACCCC
ATTGTCCTTACTGGCGATATGTGGCGTTTGAACCTTCCAGAGGACTCGAATTGGCCTGCTGTTTTGTTCATCGCC
GAAGATGGTCAGAAGGCTGTGTTGTTTGTCTTCCAGCTCGCTCCGAATGTTGATCATTCATGGCCACGCGTTAGG
TTGCAGGGATTGGATGCGCAGGCTTCCTATAAGATTGACGGGGGTGTGGTTTACTCCGGTGGAACCTTGATGAAT
ATTGGTCTGCAATTTCCTTTCAAAGGTGACTATGGCAGTCAGGTTGTGATGTTAGAAAAGCAATAG
Gene >Pro_DTO377G3_2|g711.t1
ATGGTTCACTTATCAAGGGGTGTTGTGGCCACATGTCTTACTCTCCTTGCGCATTCCTCCGGTATTACGGCTGAA
GAATCAAGCACAAATCGTGAGTCCTGTGCTTCTATTAATTTCTCATTTCCTAAACCTAACCACCTCCTATAGCAA
TCGTGGCAGATGGTACTTCCTTTGCTCTCAATGGAAATAATGTTGCATACCGCATCCATGTAGACAATACCACTG
GTGATCTCTTAGGAGACCACTTCGGCGGCTCTGTCGGAGCTCATATCCCTCTGGAAGTTGTAGGCGACGTCCATG
GCTGGAATGGTTATATCGGACGTGTACGCCGCGAGTTCCCAGACCAAGGCCGAGGAGATTTCAGGACCCCTGCGA
TTCGCATTCGTCAGTCACAAGGGTATACCGTGTCTGAATTCCAGTACAAATCGTACAAGATCATCCCCGGAAAGC
CTGCTCTACCTGGGTTGCCAGCCACGACGGGCACAGAAGAAGATGTGAGCACCTTGGTTATCAGTCTATATGACA
AGTACAGCGATGTTGGTGCAGACCTCTCCTACTCGATTTTCCCTAAGTATGATGCCATTGTGCGCAGCGTGAATA
TCACGAATCACGGAAAGGCAAATATCACAATCGAGTCTCTGGCAAGTCTGAGCGTGGATTTGCCGTTCGAGGACC
TCGACATGATAAGTCTTCGCGGTGATTGGGCAAGGGAAGCGCATCGCGAAAGGAAAAAGGTCACGTACGGCACCC
AAGGCTTTGGAAGTTCCACTGGCTACTCCTCTCACCTCCATAACCCTTTCCTGGCATTGACAGAGCCTTCCGCTA
CCGAGTCTCACGGAGAGGTATGGGGATTCTCGCTTGTGTACACTGGTTCATTCTCCGTGAATGTCGAGAAGGGCT
CGCAGGGCTTCACGCGTGCCCTTTTGGGTTTCAACCCTAGCCAGCTCTCGTGGAATCTGCCGCCCGGGGAAACCC
TTACTTCTCCCGAGTGTGTCTCGGTATACTCCAAGGATGGCATCGGCGGAATGTCACGCTCTCTACATCGCCTGT
ACCGCAAGCATCTCATCAAGAGCAAGTTTGCCACCAGTGATCGTCCTACGTTGTTGAACAGTTGGGAAGGATTGT
ATTTCGATTACAATCAGAGTAGCATCTACGACTTGGCAAAGGAAGCCGCCGAAGTAGGTGCCAAGCTCTTTGTTC
TGGATGACGGTTGGTTTGGCCGGGAATATCCACGTCTCTCCGACGACGCCGGACTGGGCGACTGGATCCCAAACC
CTGACCGGTTCCCAGACGGCCTGGGGCCGATTGTGAAGAATATCACGGACCTGAAAGCAGCTAACTCGTCAACGA
ACATGCGCTTCGGTATCTGGTTCGAGCCGGAAATGGTCAATCCGAACTCGACTCTGTATAACGAGCACCCGGACT
GGGCCTTACACGCAGGACCCTACCCTCGCACCGAAAGGCGCAATCAGCTCGTGCTGAATCTCGCTCTTCCTGAAG
TCCAAGACTACATCATCAAGTCCGTCTCAGACGTCCTCAAGAGTGCAGATATCAGTTACGTCAAGTGGGACAACA
ACAGGGGTATCCACGAGATGCCTTCCCCGGCCACAGACCACGCCTATATTCTCGGTATGTACCGTGTTTTCGATG
AACTAACAACCCAATTCCCTGATATCCTCTGGGAGGGCTGCGCCTCGGGCGGAGGCCGGTTCGACCCAGGTGTTC
TGCAGTACTTCCCTCAGATCTGGACATCGGATAACACAGATGCAATCGATCGCATCTCCATTCAGCTTGGTACTT
CGCTCGCCTACCCGCCCAGCGCGATGGGTGCTCACCTGTCCGAAGTACCGAACCAACAGACTGGCCGCACAGTCC
CGGTGGCTGTCCGCGGACATGTCGCGATGATGGCTGGCTCGTTTGGCTTGGAGCTCGATCCGGCTGTAATGAACG
CGGAGGACAAGGCGGCTCTGCCGGGTCTCATTGCTCTTGCTGAGAAGGTGAACCCCATTGTCCTTACTGGCGATA
TGTGGCGTTTGAACCTTCCAGAGGACTCGAATTGGCCTGCTGTTTTGTTCATCGCCGAAGATGGTCAGAAGGCTG
TGTTGTTTGTCTTCCAGCTCGCTCCGAATGTTGATCATTCATGGCCACGCGTTAGGTTGCAGGGATTGGATGCGC
AGGCTTCCTATAAGATTGACGGGGGTGTGGTTTACTCCGGTGGAACCTTGATGAATATTGGTCTGCAATTTCCTT
TCAAAGGTGACTATGGCAGTCAGGTTGTGATGTTAGAAAAGCAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail