Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7101.t1
Gene name
Locationscaffold_21:56531..58244
Strand-
Gene length (bp)1713
Transcript length (bp)1545
Coding sequence length (bp)1545
Protein length (aa) 515

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 4.6E-57 47 312
PF00734 CBM_1 Fungal cellulose binding domain 3.1E-13 483 510

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0071704 organic substance metabolic process Yes
GO:0005576 extracellular region Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0030248 cellulose binding Yes
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0005575 cellular_component No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044238 primary metabolic process No
GO:0030247 polysaccharide binding No
GO:0110165 cellular anatomical entity No
GO:0030246 carbohydrate binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 71.16 42.05 100.27
5d_25C Five days - 25 degrees Celsius 48.70 27.52 69.88
7d_25C Seven days - 25 degrees Celsius 39.08 21.11 57.05
10d_25C Ten days - 25 degrees Celsius 23.11 11.23 34.99
7d_15C Seven days - 15 degrees Celsius 33.19 14.72 51.66
7d_30C Seven days - 30 degrees Celsius 43.76 23.20 64.31

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.096746 no
3d_25C 7d_25C 0.007091 yes
3d_25C 7d_15C 0.005626 yes
3d_25C 7d_30C 0.037779 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.431454 no
5d_25C 7d_15C 0.180281 no
5d_25C 7d_30C 0.744249 no
5d_25C 10d_25C 0.002297 yes
7d_25C 7d_15C 0.643295 no
7d_25C 7d_30C 0.735102 no
7d_25C 10d_25C 0.039155 yes
7d_15C 7d_30C 0.378894 no
7d_15C 10d_25C 0.246480 no
7d_30C 10d_25C 0.007779 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7101.t1
MKFTNIVLAASAATVACAYPRTRDVVPTRQSANIKKRANGFTWVGVNESGAEFASGSIPGTLNTDYTWPKTDQIQ
ILRDAGMNIFRVPFLMERLVPSSMTGTADATYLAALKTTVQFITDSGAYAIIDPHNYGRYSGNIITSTSDFGAFW
KTVAAEFATNEKVIFDTNNEYHGLDQTLVLDLNQAAINAIRAAGATSQYIFVEGNAWSGAYSWVATNDNLKALTD
SADKIVYEMHQYLDSDSSGTSETCVSTTIGKERLESATTWLQDNNKKGFIGEFAGGVNSDCETAVEGMLSYMSDN
SDVWVGASWWSAGPWWGSYMYNLEPSNGPAYATYLPILEKYFVDGTASAVTSSSSSSSSTSTTAAQTSSTKTAAQ
TSATTTAQTSTSTKNAVQTSTTTAAQTSSTTTAAAQVPTSVTSSSSTTTAPAASAPTTTTTVVVPSTLVTLTSTV
TSTTTAATSTTTATAYAQVPTSGSSTVNIAKHYYQCGGINWTGATACESGTTCVKQNPYYSQCL*
Coding >Pro_DTO377G3_2|g7101.t1
ATGAAGTTCACTAACATTGTCCTGGCTGCCAGCGCCGCAACTGTGGCCTGCGCATACCCCCGAACAAGAGACGTT
GTTCCTACCAGGCAGAGCGCTAATATCAAGAAGCGCGCCAATGGATTCACTTGGGTCGGCGTGAACGAGTCCGGT
GCTGAATTTGCCTCGGGCAGCATCCCCGGTACTCTGAACACAGACTACACCTGGCCCAAGACTGATCAGATTCAG
ATCCTGCGAGATGCGGGCATGAACATCTTCCGTGTGCCCTTCTTGATGGAGCGCCTGGTGCCATCCAGCATGACC
GGCACCGCGGATGCTACTTACCTGGCCGCTCTTAAGACTACTGTCCAGTTCATTACCGACAGCGGTGCCTATGCC
ATCATTGACCCCCACAACTACGGAAGATACTCTGGCAATATCATCACCTCGACCTCTGATTTCGGCGCCTTCTGG
AAGACCGTTGCTGCTGAGTTCGCCACTAACGAGAAGGTCATCTTCGATACCAACAACGAGTACCACGGCCTTGAT
CAGACTCTCGTTCTGGACCTGAACCAGGCCGCTATTAACGCTATCCGTGCCGCTGGTGCCACCAGCCAGTACATC
TTCGTTGAAGGTAACGCATGGAGCGGCGCCTATTCCTGGGTCGCCACCAACGACAACCTGAAGGCCCTTACCGAC
TCCGCGGACAAGATCGTCTACGAGATGCACCAGTACCTGGACAGCGACAGCTCCGGTACCTCCGAGACCTGTGTC
AGCACCACCATCGGTAAGGAGCGTCTCGAGTCCGCCACCACCTGGTTGCAGGACAACAACAAGAAGGGCTTCATC
GGCGAGTTCGCCGGTGGCGTCAACAGCGACTGCGAGACTGCCGTCGAGGGCATGCTCTCCTACATGTCCGACAAC
AGCGACGTCTGGGTCGGCGCCTCGTGGTGGTCTGCCGGTCCCTGGTGGGGATCTTACATGTACAACTTGGAGCCC
AGCAATGGCCCTGCTTACGCGACTTACCTGCCCATCCTCGAGAAGTACTTCGTGGACGGCACTGCCTCAGCCGTG
ACCTCCTCGTCTTCCTCTTCTTCATCCACCTCCACCACCGCTGCCCAGACATCCTCTACTAAGACCGCCGCTCAG
ACATCCGCTACTACCACTGCGCAGACATCTACATCCACCAAGAACGCCGTTCAGACATCCACCACCACCGCTGCC
CAGACGTCCAGCACCACTACCGCTGCCGCCCAGGTCCCCACCTCGGTGACCTCGTCTTCCTCGACCACCACAGCT
CCCGCAGCGTCAGCTCCCACGACCACCACCACGGTTGTCGTCCCGTCCACCCTCGTCACCCTCACCTCCACCGTG
ACCTCGACCACCACCGCCGCCACCTCCACCACGACCGCTACGGCATATGCTCAGGTACCTACCAGCGGCTCCTCT
ACTGTGAACATTGCTAAGCACTATTACCAGTGCGGTGGCATCAACTGGACCGGCGCCACTGCTTGCGAGAGCGGC
ACCACTTGCGTCAAGCAGAACCCTTACTATTCCCAGTGTCTTTAA
Transcript >Pro_DTO377G3_2|g7101.t1
ATGAAGTTCACTAACATTGTCCTGGCTGCCAGCGCCGCAACTGTGGCCTGCGCATACCCCCGAACAAGAGACGTT
GTTCCTACCAGGCAGAGCGCTAATATCAAGAAGCGCGCCAATGGATTCACTTGGGTCGGCGTGAACGAGTCCGGT
GCTGAATTTGCCTCGGGCAGCATCCCCGGTACTCTGAACACAGACTACACCTGGCCCAAGACTGATCAGATTCAG
ATCCTGCGAGATGCGGGCATGAACATCTTCCGTGTGCCCTTCTTGATGGAGCGCCTGGTGCCATCCAGCATGACC
GGCACCGCGGATGCTACTTACCTGGCCGCTCTTAAGACTACTGTCCAGTTCATTACCGACAGCGGTGCCTATGCC
ATCATTGACCCCCACAACTACGGAAGATACTCTGGCAATATCATCACCTCGACCTCTGATTTCGGCGCCTTCTGG
AAGACCGTTGCTGCTGAGTTCGCCACTAACGAGAAGGTCATCTTCGATACCAACAACGAGTACCACGGCCTTGAT
CAGACTCTCGTTCTGGACCTGAACCAGGCCGCTATTAACGCTATCCGTGCCGCTGGTGCCACCAGCCAGTACATC
TTCGTTGAAGGTAACGCATGGAGCGGCGCCTATTCCTGGGTCGCCACCAACGACAACCTGAAGGCCCTTACCGAC
TCCGCGGACAAGATCGTCTACGAGATGCACCAGTACCTGGACAGCGACAGCTCCGGTACCTCCGAGACCTGTGTC
AGCACCACCATCGGTAAGGAGCGTCTCGAGTCCGCCACCACCTGGTTGCAGGACAACAACAAGAAGGGCTTCATC
GGCGAGTTCGCCGGTGGCGTCAACAGCGACTGCGAGACTGCCGTCGAGGGCATGCTCTCCTACATGTCCGACAAC
AGCGACGTCTGGGTCGGCGCCTCGTGGTGGTCTGCCGGTCCCTGGTGGGGATCTTACATGTACAACTTGGAGCCC
AGCAATGGCCCTGCTTACGCGACTTACCTGCCCATCCTCGAGAAGTACTTCGTGGACGGCACTGCCTCAGCCGTG
ACCTCCTCGTCTTCCTCTTCTTCATCCACCTCCACCACCGCTGCCCAGACATCCTCTACTAAGACCGCCGCTCAG
ACATCCGCTACTACCACTGCGCAGACATCTACATCCACCAAGAACGCCGTTCAGACATCCACCACCACCGCTGCC
CAGACGTCCAGCACCACTACCGCTGCCGCCCAGGTCCCCACCTCGGTGACCTCGTCTTCCTCGACCACCACAGCT
CCCGCAGCGTCAGCTCCCACGACCACCACCACGGTTGTCGTCCCGTCCACCCTCGTCACCCTCACCTCCACCGTG
ACCTCGACCACCACCGCCGCCACCTCCACCACGACCGCTACGGCATATGCTCAGGTACCTACCAGCGGCTCCTCT
ACTGTGAACATTGCTAAGCACTATTACCAGTGCGGTGGCATCAACTGGACCGGCGCCACTGCTTGCGAGAGCGGC
ACCACTTGCGTCAAGCAGAACCCTTACTATTCCCAGTGTCTTTAA
Gene >Pro_DTO377G3_2|g7101.t1
ATGAAGTTCACTAACATTGTCCTGGCTGCCAGCGCCGCAACTGTGGCCTGCGCATACCCCCGAACAAGAGACGTT
GTTCCTACCAGGCAGAGCGCTAATATCAAGAAGCGCGCCAATGGATTCACTTGGGTCGGCGTGAACGAGTCCGGT
GCTGAATTTGCCTCGGGCAGCATCCCCGGTACTCTGAACACAGACTACACCTGGCCCAAGACTGATCAGATTCAG
ATCCTGCGAGATGCGGGCATGAACATCTTCCGTGTGCCCTTCTTGATGGAGCGCCTGGTGCCATCCAGCATGACC
GGCACCGCGGATGCTACTTACCTGGCCGCTCTTAAGACTGTACGTGATGTCTGTCGTAGTTGATTCTCTTCCAGA
TCTAACAGTTCTATTATGTAGACTGTCCAGTTCATTACCGACAGCGGTGCCTATGCCATCATTGACCCCCACAAC
TACGGAAGATAGTAAGTGTATAAAACTAGAACCCACCGTGATGTATGATACTAATTGCTCATTTACAGCTCTGGC
AATATCATCACCTCGACCTCTGATTTCGGCGCCTTCTGGAAGACCGTTGCTGCTGAGTTCGCCACTAACGAGAAG
GTCATCTTCGATACCAGTAAGTCACCTAGAGGCACCCATACCATGGTAATAATCCACTAATATCATTTAGACAAC
GAGTACCACGGCCTTGATCAGACTCTCGTTCTGGACCTGAACCAGGCCGCTATTAACGCTATCCGTGCCGCTGGT
GCCACCAGCCAGTACATCTTCGTTGAAGGTAACGCATGGAGCGGCGCCTATTCCTGGGTCGCCACCAACGACAAC
CTGAAGGCCCTTACCGACTCCGCGGACAAGATCGTCTACGAGATGCACCAGTACCTGGACAGCGACAGCTCCGGT
ACCTCCGAGACCTGTGTCAGCACCACCATCGGTAAGGAGCGTCTCGAGTCCGCCACCACCTGGTTGCAGGACAAC
AACAAGAAGGGCTTCATCGGCGAGTTCGCCGGTGGCGTCAACAGCGACTGCGAGACTGCCGTCGAGGGCATGCTC
TCCTACATGTCCGACAACAGCGACGTCTGGGTCGGCGCCTCGTGGTGGTCTGCCGGTCCCTGGTGGGGATCTTAC
ATGTACAACTTGGAGCCCAGCAATGGCCCTGCTTACGCGACTTACCTGCCCATCCTCGAGAAGTACTTCGTGGAC
GGCACTGCCTCAGCCGTGACCTCCTCGTCTTCCTCTTCTTCATCCACCTCCACCACCGCTGCCCAGACATCCTCT
ACTAAGACCGCCGCTCAGACATCCGCTACTACCACTGCGCAGACATCTACATCCACCAAGAACGCCGTTCAGACA
TCCACCACCACCGCTGCCCAGACGTCCAGCACCACTACCGCTGCCGCCCAGGTCCCCACCTCGGTGACCTCGTCT
TCCTCGACCACCACAGCTCCCGCAGCGTCAGCTCCCACGACCACCACCACGGTTGTCGTCCCGTCCACCCTCGTC
ACCCTCACCTCCACCGTGACCTCGACCACCACCGCCGCCACCTCCACCACGACCGCTACGGCATATGCTCAGGTA
CCTACCAGCGGCTCCTCTACTGTGAACATTGCTAAGCACTATTACCAGTGCGGTGGCATCAACTGGACCGGCGCC
ACTGCTTGCGAGAGCGGCACCACTTGCGTCAAGCAGAACCCTTACTATTCCCAGTGTCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail