Fungal Genomics

at Utrecht University

General Properties

Protein IDPro_DTO377G3_2|g7080.t1
Gene name
Locationscaffold_21:11139..12108
Strand-
Gene length (bp)969
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02567 PhzC-PhzF Phenazine biosynthesis-like protein 3.6E-10 34 204

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0009058 biosynthetic process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Genome-wide gene expression in conidia of Penicillium roqueforti during growth at various temperatures and for various amounts of time. Published in Punt et al., 2020.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
3d_25C Three days - 25 degrees Celsius 77.79 46.40 109.18
5d_25C Five days - 25 degrees Celsius 354.75 206.71 502.78
7d_25C Seven days - 25 degrees Celsius 461.67 269.58 653.76
10d_25C Ten days - 25 degrees Celsius 1091.53 587.57 1595.50
7d_15C Seven days - 15 degrees Celsius 207.03 120.82 293.25
7d_30C Seven days - 30 degrees Celsius 440.21 248.74 631.68

Differential expression

Label1 Label2 Q-value Significant difference
3d_25C 5d_25C 0.000700 yes
3d_25C 7d_25C 0.000700 yes
3d_25C 7d_15C 0.000700 yes
3d_25C 7d_30C 0.000700 yes
3d_25C 10d_25C 0.000700 yes
5d_25C 7d_25C 0.281027 no
5d_25C 7d_15C 0.011688 yes
5d_25C 7d_30C 0.419820 no
5d_25C 10d_25C 0.000700 yes
7d_25C 7d_15C 0.000700 yes
7d_25C 7d_30C 0.895315 no
7d_25C 10d_25C 0.000700 yes
7d_15C 7d_30C 0.000700 yes
7d_15C 10d_25C 0.000700 yes
7d_30C 10d_25C 0.000700 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Pro_DTO377G3_2|g7080.t1
MEATSSLPHPSVIENVQAHILRVSPAGPDGKGIISVVLNANGLSDEEMQKLTTNYGHPSGFVFSAPADSDLDYEI
RVWHPDHELEKCAHVMIGTVWLLSKLGMMPRGDLRILTKSDCVEAKITKTTDKDNAKENIWVEFFNLACDMNTVN
TENMDVILSDLKISRSDIAPGMVHNAGTVDDADTDIISTTLIPIRSVRRLRDLKLSDDLVKKLLERIQSPGLCLY
AIVDEIRQEYEVRQVPEPDANWEDTTTALAFALLINGFVDRPVEPLQIREPCDNDRYREINLRFRLGGGNASGCW
IGGTAEFETEEKETGQTKTDAE*
Coding >Pro_DTO377G3_2|g7080.t1
ATGGAGGCGACATCATCTCTACCACATCCATCTGTAATAGAGAATGTCCAAGCCCACATTCTACGGGTCTCTCCT
GCAGGTCCAGACGGCAAGGGTATAATTTCAGTTGTCCTAAATGCCAATGGCCTGTCCGACGAAGAAATGCAAAAA
CTTACCACAAATTACGGCCACCCGAGCGGGTTCGTCTTCTCCGCACCAGCAGACTCCGACTTGGACTATGAGATC
CGCGTCTGGCACCCAGACCATGAACTAGAGAAGTGTGCTCATGTAATGATCGGAACCGTGTGGCTACTCTCGAAG
CTTGGGATGATGCCGCGGGGCGACCTCCGCATCTTGACCAAGAGCGACTGTGTGGAAGCAAAGATCACGAAGACC
ACCGACAAAGACAACGCCAAGGAGAACATCTGGGTTGAGTTCTTCAACCTGGCATGTGACATGAACACTGTGAAT
ACCGAAAACATGGATGTCATTCTGTCCGATTTGAAGATTTCGAGATCTGACATTGCACCTGGAATGGTCCACAAT
GCTGGCACGGTCGACGATGCTGACACGGACATAATCTCAACGACACTGATTCCGATCAGATCGGTTAGGAGATTG
CGTGACTTGAAGCTGAGCGATGATCTCGTCAAGAAGCTTCTTGAAAGGATTCAGAGCCCTGGATTGTGTCTGTAT
GCCATCGTCGACGAAATACGGCAGGAGTACGAAGTGAGACAGGTTCCTGAACCTGATGCGAATTGGGAGGACACC
ACGACTGCTTTGGCTTTTGCGCTTTTGATAAATGGCTTTGTCGACAGACCTGTTGAGCCACTTCAGATCAGGGAG
CCTTGCGACAACGACCGTTACCGTGAGATTAATTTGAGGTTCAGGCTTGGGGGTGGCAATGCCAGTGGCTGTTGG
ATTGGAGGTACAGCCGAGTTTGAAACCGAGGAGAAAGAGACTGGACAGACAAAGACCGATGCTGAATAG
Transcript >Pro_DTO377G3_2|g7080.t1
ATGGAGGCGACATCATCTCTACCACATCCATCTGTAATAGAGAATGTCCAAGCCCACATTCTACGGGTCTCTCCT
GCAGGTCCAGACGGCAAGGGTATAATTTCAGTTGTCCTAAATGCCAATGGCCTGTCCGACGAAGAAATGCAAAAA
CTTACCACAAATTACGGCCACCCGAGCGGGTTCGTCTTCTCCGCACCAGCAGACTCCGACTTGGACTATGAGATC
CGCGTCTGGCACCCAGACCATGAACTAGAGAAGTGTGCTCATGTAATGATCGGAACCGTGTGGCTACTCTCGAAG
CTTGGGATGATGCCGCGGGGCGACCTCCGCATCTTGACCAAGAGCGACTGTGTGGAAGCAAAGATCACGAAGACC
ACCGACAAAGACAACGCCAAGGAGAACATCTGGGTTGAGTTCTTCAACCTGGCATGTGACATGAACACTGTGAAT
ACCGAAAACATGGATGTCATTCTGTCCGATTTGAAGATTTCGAGATCTGACATTGCACCTGGAATGGTCCACAAT
GCTGGCACGGTCGACGATGCTGACACGGACATAATCTCAACGACACTGATTCCGATCAGATCGGTTAGGAGATTG
CGTGACTTGAAGCTGAGCGATGATCTCGTCAAGAAGCTTCTTGAAAGGATTCAGAGCCCTGGATTGTGTCTGTAT
GCCATCGTCGACGAAATACGGCAGGAGTACGAAGTGAGACAGGTTCCTGAACCTGATGCGAATTGGGAGGACACC
ACGACTGCTTTGGCTTTTGCGCTTTTGATAAATGGCTTTGTCGACAGACCTGTTGAGCCACTTCAGATCAGGGAG
CCTTGCGACAACGACCGTTACCGTGAGATTAATTTGAGGTTCAGGCTTGGGGGTGGCAATGCCAGTGGCTGTTGG
ATTGGAGGTACAGCCGAGTTTGAAACCGAGGAGAAAGAGACTGGACAGACAAAGACCGATGCTGAATAG
Gene >Pro_DTO377G3_2|g7080.t1
ATGGAGGCGACATCATCTCTACCACATCCATCTGTAATAGAGAATGTCCAAGCCCACATTCTACGGGTCTCTCCT
GCAGGTCCAGACGGCAAGGGTATAATTTCAGTTGTCCTAAATGCCAATGGCCTGTCCGACGAAGAAATGCAAAAA
CTTACCACAAATTACGGCCACCCGAGCGGGTTCGTCTTCTCCGCACCAGCAGACTCCGACTTGGACTATGAGATC
CGCGTCTGGCACCCAGACCATGAACTAGAGAAGTGTGCTCATGTAATGATCGGAACCGTGTGGCTACTCTCGAAG
CTTGGGATGATGCCGCGGGGCGACCTCCGCATCTTGACCAAGAGCGACTGTGTGGAAGCAAAGATCACGAAGACC
ACCGACAAAGACAACGCCAAGGAGAACATCTGGGTTGAGTTCTTCAACCTGGCATGTGACATGAACACTGTGAAT
ACCGAAAACATGGATGTCATTCTGTCCGATTTGAAGATTTCGAGATCTGACATTGCACCTGGAATGGTCCACAAT
GCTGGCACGGTCGACGATGCTGACACGGACATAATCTCAACGACACTGATTCCGATCAGATCGGTTAGGAGATTG
CGTGACTTGAAGCTGAGCGATGATCTCGTCAAGAAGCTTCTTGAAAGGATTCAGAGCCCTGGATTGTGTCTGTAT
GCCATCGTCGACGAAATACGGCAGGAGTACGAAGTGAGACAGGTTCCTGAACCTGATGCGAATTGGGAGGACACC
ACGACTGCTTTGGCTTTTGCGCTTTTGATAAATGGCTTTGTCGACAGACCTGTTGAGCCACTTCAGATCAGGGAG
CCTTGCGACAACGACCGTTACCGTGAGATTAATTTGAGGTTCAGGCTTGGGGGTGGCAATGCCAGTGGCTGTTGG
ATTGGAGGTACAGCCGAGTTTGAAACCGAGGAGAAAGAGACTGGACAGACAAAGACCGATGCTGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail